Gene Information

Name : YE0975A (YE0975A)
Accession : YP_001005309.1
Strain : Yersinia enterocolitica 8081
Genome accession: NC_008800
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 1098498 - 1098698 bp
Length : 201 bp
Strand : +
Note : Similar to many including: Escherichia coli O157:H7 putative DNA binding protein Z3946 or ecs3513 SWALL:Q8X969 (EMBL:AE005493) (68 aa) fasta scores: E(): 1.1e-17, 69.23 id in 65 aa, and to Yersinia pestis putative regulatory protein Ypo0878 SWALL:Q8ZHL3 (

DNA sequence :
ATGAACAACTCCCGCCTCATCCGCTTGCCAGAGGTTATGAACAGAACTGGCTACTGCAAAGCTTGGATCTATCGTCTGAT
CAACGATGGCAAGTTTCCTGTACCTGTCAAAATTGGAACTCGTGCAGTAGCTTTCGTAGAAAGTGAGGTTGATGCCTGGG
TTCACTCTGTTATCGAAACAAGTCGAAAAAATGTTGCTTAA

Protein sequence :
MNNSRLIRLPEVMNRTGYCKAWIYRLINDGKFPVPVKIGTRAVAFVESEVDAWVHSVIETSRKNVA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
VC0395_A1382 YP_001217325.1 transcriptional regulator Not tested VPI-2 Protein 1e-07 51
VPI2_0033 AAX20900.1 transcriptional regulator Not tested VPI-2 Protein 7e-08 51
VC1785 NP_231420.1 transcriptional regulator Not tested VPI-2 Protein 1e-07 51
VPI2_0041 ACA01856.1 predicted transcriptional regulator Not tested VPI-2 Protein 4e-09 46
VC1809 NP_231443.1 transcriptional regulator Not tested VPI-2 Protein 3e-09 45
VC0395_A1406 YP_001217349.1 transcriptional regulator Not tested VPI-2 Protein 3e-09 45
VC0497 NP_230151.1 transcriptional regulator Not tested VSP-2 Protein 1e-05 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YE0975A YP_001005309.1 hypothetical protein VFG1118 Protein 3e-08 51
YE0975A YP_001005309.1 hypothetical protein VFG1141 Protein 9e-10 45