
|
Name : YE0975A (YE0975A) Accession : YP_001005309.1 Strain : Yersinia enterocolitica 8081 Genome accession: NC_008800 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 1098498 - 1098698 bp Length : 201 bp Strand : + Note : Similar to many including: Escherichia coli O157:H7 putative DNA binding protein Z3946 or ecs3513 SWALL:Q8X969 (EMBL:AE005493) (68 aa) fasta scores: E(): 1.1e-17, 69.23 id in 65 aa, and to Yersinia pestis putative regulatory protein Ypo0878 SWALL:Q8ZHL3 ( DNA sequence : ATGAACAACTCCCGCCTCATCCGCTTGCCAGAGGTTATGAACAGAACTGGCTACTGCAAAGCTTGGATCTATCGTCTGAT CAACGATGGCAAGTTTCCTGTACCTGTCAAAATTGGAACTCGTGCAGTAGCTTTCGTAGAAAGTGAGGTTGATGCCTGGG TTCACTCTGTTATCGAAACAAGTCGAAAAAATGTTGCTTAA Protein sequence : MNNSRLIRLPEVMNRTGYCKAWIYRLINDGKFPVPVKIGTRAVAFVESEVDAWVHSVIETSRKNVA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| VPI2_0033 | AAX20900.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 7e-08 | 51 |
| VC1785 | NP_231420.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 51 |
| VC0395_A1382 | YP_001217325.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 1e-07 | 51 |
| VPI2_0041 | ACA01856.1 | predicted transcriptional regulator | Not tested | VPI-2 | Protein | 4e-09 | 46 |
| VC0395_A1406 | YP_001217349.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-09 | 45 |
| VC1809 | NP_231443.1 | transcriptional regulator | Not tested | VPI-2 | Protein | 3e-09 | 45 |
| VC0497 | NP_230151.1 | transcriptional regulator | Not tested | VSP-2 | Protein | 1e-05 | 44 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| YE0975A | YP_001005309.1 | hypothetical protein | VFG1118 | Protein | 3e-08 | 51 |
| YE0975A | YP_001005309.1 | hypothetical protein | VFG1141 | Protein | 9e-10 | 45 |