Gene Information

Name : tnpA (YE0831)
Accession : YP_001005169.1
Strain : Yersinia enterocolitica 8081
Genome accession: NC_008800
Putative virulence/resistance : Unknown
Product : IS1329 transposase A
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 957461 - 957793 bp
Length : 333 bp
Strand : +
Note : Previously sequenced as Yersinia enterocolitica IS1329 transposase A Trp1329A SWALL:Q9X9I2 (EMBL:AJ132945) (110 aa) fasta scores: E(): 1.8e-38, 100 38d in 110 aa. Also similar to Shigella dysenteriae transposase InsN for insertion sequence element IS911 S

DNA sequence :
ATGAGCAACACTAACGAGGTGAGAATGCGAAAAAAATCATTTACTCATGAGTTTAAACAAGAGTGCGTCAACCTGGTTCT
TCAACATAAGTACCCGGTGACTCAGGCTGCTGAAACAATGAATATTGGCCTTTCAACCTTACAACGCTGGCTACGGCAGT
ATCGCGGAGAGAGCCGCGGAAATACACCGATAGCCAGTGCTATAACACCGGAACAACGCCGAATACAAGAACTTGAAAAG
CAGGTGCGGCAGTTACAGAGCGACAATGACCTGTTAAAAAAGGCTTCGGCCTTCTTCGCCATGGAAATGAACAACGACAA
AAAGTCGCGGTAA

Protein sequence :
MSNTNEVRMRKKSFTHEFKQECVNLVLQHKYPVTQAAETMNIGLSTLQRWLRQYRGESRGNTPIASAITPEQRRIQELEK
QVRQLQSDNDLLKKASAFFAMEMNNDKKSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 2e-47 100
tnpA CAB61575.1 transposase A Not tested HPI Protein 6e-47 99
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 3e-20 52
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 2e-20 52
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-20 50
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-20 50
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-20 50
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-20 50
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-20 49
l7045 CAD33744.1 - Not tested PAI I 536 Protein 1e-20 49
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 1e-20 49
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-18 49
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-18 49
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-18 49
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-18 49
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-18 49
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-18 49
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-18 49
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-18 49
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-20 47
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-16 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
tnpA YP_001005169.1 IS1329 transposase A VFG0784 Protein 2e-20 50
tnpA YP_001005169.1 IS1329 transposase A VFG1485 Protein 5e-21 49
tnpA YP_001005169.1 IS1329 transposase A VFG1123 Protein 7e-19 49
tnpA YP_001005169.1 IS1329 transposase A VFG1553 Protein 9e-17 43