Gene Information

Name : YE3878 (YE3878)
Accession : YP_001008023.1
Strain : Yersinia enterocolitica 8081
Genome accession: NC_008800
Putative virulence/resistance : Unknown
Product : putative transposase for insertion sequence element IS1666
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 4231986 - 4232285 bp
Length : 300 bp
Strand : -
Note : Similar to many transposases including: Yersinia enterocolitica IS1329 transposase A SWALL:Q9X9I2 (EMBL:AJ132945) (110 aa) fasta scores: E(): 1.4e-10, 40.2 id in 97 aa and Shigella dysenteriae transposase InsN for insertion sequence element IS911 InsN SWA

DNA sequence :
ATGACCAAATATTTTACGGCTGAATTTAAACTCGAAGCAGCAAAGTTGGTTGTTGACCAGAAATACTCTCATTCGGAGGC
CGCTAAAGCCATGAATGTCAGTCTTTCCGCCCTTAGCCGATGGGTGGGTAAGCTCAGATTGGAACGTCAGGGTAAAACCC
CCGTTGGGCTTCCACTGACGCCTGAACAAATAGAACTTCGGGAAATGAAGAAAAGGATTCAACGTCTTGAAATGGAGAAC
GAAATTCTAAAAAAGGCCACCGCTCTCTTGATGTCGGACTCGTTGAACAGTTCGCGATAG

Protein sequence :
MTKYFTAEFKLEAAKLVVDQKYSHSEAAKAMNVSLSALSRWVGKLRLERQGKTPVGLPLTPEQIELREMKKRIQRLEMEN
EILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-35 85
l7045 CAD33744.1 - Not tested PAI I 536 Protein 8e-29 70
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 8e-29 70
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 69
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 69
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 69
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-25 69
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 69
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-25 69
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 8e-26 69
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 8e-26 69
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-27 68
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-23 64
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 5e-22 59
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-22 59
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-20 58
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-20 58
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-20 58
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-20 58
unnamed AAC31483.1 L0004 Not tested LEE Protein 1e-20 58
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-10 44
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 6e-16 44
tnpA CAB61575.1 transposase A Not tested HPI Protein 2e-15 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
YE3878 YP_001008023.1 putative transposase for insertion sequence element IS1666 VFG1553 Protein 1e-35 85
YE3878 YP_001008023.1 putative transposase for insertion sequence element IS1666 VFG1485 Protein 3e-29 70
YE3878 YP_001008023.1 putative transposase for insertion sequence element IS1666 VFG1123 Protein 3e-26 69
YE3878 YP_001008023.1 putative transposase for insertion sequence element IS1666 VFG0784 Protein 5e-21 58
YE3878 YP_001008023.1 putative transposase for insertion sequence element IS1666 VFG1566 Protein 9e-11 44