Name : tnpA (YE3043) Accession : YP_001007227.1 Strain : Yersinia enterocolitica 8081 Genome accession: NC_008800 Putative virulence/resistance : Unknown Product : IS1329 transposase A Function : - COG functional category : L : Replication, recombination and repair COG ID : COG2963 EC number : - Position : 3310600 - 3310932 bp Length : 333 bp Strand : + Note : Previously sequenced as Yersinia enterocolitica IS1329 transposase A Trp1329A SWALL:Q9X9I2 (EMBL:AJ132945) (110 aa) fasta scores: E(): 1.8e-38, 100 38d in 110 aa. Also similar to Shigella dysenteriae transposase InsN for insertion sequence element IS911 S DNA sequence : ATGAGCAACACTAACGAGGTGAGAATGCGAAAAAAATCATTTACTCATGAGTTTAAACAAGAGTGCGTCAACCTGGTTCT TCAACATAAGTACCCGGTGACTCAGGCTGCTGAAACAATGAATATTGGCCTTTCAACCTTACAACGCTGGCTACGGCAGT ATCGCGGAGAGAGCCGCGGAAATACACCGATAGCCAGTGCTATAACACCGGAACAACGCCGAATACAAGAACTTGAAAAG CAGGTGCGGCAGTTACAGAGCGACAATGACCTGTTAAAAAAGGCTTCGGCCTTCTTCGCCATGGAAATGAACAACGACAA AAAGTCGCGGTAA Protein sequence : MSNTNEVRMRKKSFTHEFKQECVNLVLQHKYPVTQAAETMNIGLSTLQRWLRQYRGESRGNTPIASAITPEQRRIQELEK QVRQLQSDNDLLKKASAFFAMEMNNDKKSR |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
trp1329A | CAB46577.1 | IS1329 transposase A | Not tested | HPI | Protein | 2e-47 | 100 |
tnpA | CAB61575.1 | transposase A | Not tested | HPI | Protein | 6e-47 | 99 |
ECO111_3778 | YP_003236113.1 | putative IS602 transposase OrfA | Not tested | LEE | Protein | 3e-20 | 52 |
aec66 | AAW51749.1 | Aec66 | Not tested | AGI-3 | Protein | 2e-20 | 52 |
unnamed | ACU09431.1 | IS911 transposase orfA | Not tested | LEE | Protein | 6e-20 | 50 |
Z5088 | NP_290240.1 | hypothetical protein | Not tested | LEE | Protein | 7e-20 | 50 |
ECs4535 | NP_312562.1 | hypothetical protein | Not tested | LEE | Protein | 7e-20 | 50 |
unnamed | AAC31483.1 | L0004 | Not tested | LEE | Protein | 5e-20 | 50 |
api80 | CAF28554.1 | putative transposase | Not tested | YAPI | Protein | 1e-20 | 49 |
l7045 | CAD33744.1 | - | Not tested | PAI I 536 | Protein | 1e-20 | 49 |
orfA | CAE85179.1 | OrfA protein, IS911 | Not tested | PAI V 536 | Protein | 1e-20 | 49 |
VPI2_0009c | ACA01826.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 2e-18 | 49 |
VC1790 | NP_231425.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 3e-18 | 49 |
orfA | AGK06911.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 2e-18 | 49 |
orfA | YP_001217330.1 | transposase OrfAB subunit A | Not tested | VPI-2 | Protein | 3e-18 | 49 |
unnamed | AGK06948.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 2e-18 | 49 |
orfA | AGK06994.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 2e-18 | 49 |
orfA | AGK07052.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 2e-18 | 49 |
orfA | ACX47959.1 | IS1359 transposase; OrfA | Not tested | SGI1 | Protein | 2e-18 | 49 |
insN | YP_002152325.1 | transposase for insertion sequence element IS911 | Not tested | Not named | Protein | 4e-20 | 47 |
unnamed | CAD42034.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 2e-16 | 43 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
tnpA | YP_001007227.1 | IS1329 transposase A | VFG0784 | Protein | 2e-20 | 50 |
tnpA | YP_001007227.1 | IS1329 transposase A | VFG1485 | Protein | 5e-21 | 49 |
tnpA | YP_001007227.1 | IS1329 transposase A | VFG1123 | Protein | 7e-19 | 49 |
tnpA | YP_001007227.1 | IS1329 transposase A | VFG1553 | Protein | 9e-17 | 43 |