Gene Information

Name : Veis_0344 (Veis_0344)
Accession : YP_995152.1
Strain : Verminephrobacter eiseniae EF01-2
Genome accession: NC_008786
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 387738 - 388433 bp
Length : 696 bp
Strand : -
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pau:PA14_45880 putative two-component response regulator

DNA sequence : 
ATGAAAATCCTGATCGTCGAAGACGAGCACAAGATGGCAGAGTATCTCCGCAAAGGCTTGAGCGAGCAGGGCTGCACCGT
CGATCTGGCCGCCAACGGCATCGACGGCCAGCATCTGGCAATCTGGCACGATTATGATGTGATCGTGCTCGATGCCATGC
TGCCCGGTCTGGATGGATTTTCGGTGCTGCGCTCGCTGCGCATCCTCAAACAGACGCCCGTCATCATGCTGACCGCCCGC
GACCGTGTGGAAGACCGCATCAAAGGCTTGCACGACGGTGCCGACGATTATTTGATCAAACCCTTCTCGTTTCTCGAATT
GCTGGCACGCTTGCAGGCGCTGACGCGGCGCGGCCGCGCACAGGAGCCGGCGCAACTGCGCATCGGCGACCTGCAAATCG
ACCTGCTCAGCCGCAAAGCCTTGCGCAACAACACCCGCATCGACCTCACCGCCAAGGAATTTGCGCTGCTGGCCATCATG
GCGCGCCGCCAGGGCGAGATATTATCCAAGACCGCCATCGCCGAACTGGTCTGGGACATGAATTTCGACAGCAACACCAA
CGTCGTCGAAGTCGCCATCAAACGCCTGCGCGCCAAGATCGATGCGCCGTTCAGCCAGAAACTGCTGCACACGATACGCG
GCATGGGCTATGTGCTGGAACCACGCGCCACCGCGCATGATGGGGAAGGCGGATGA

Protein sequence : 
MKILIVEDEHKMAEYLRKGLSEQGCTVDLAANGIDGQHLAIWHDYDVIVLDAMLPGLDGFSVLRSLRILKQTPVIMLTAR
DRVEDRIKGLHDGADDYLIKPFSFLELLARLQALTRRGRAQEPAQLRIGDLQIDLLSRKALRNNTRIDLTAKEFALLAIM
ARRQGEILSKTAIAELVWDMNFDSNTNVVEVAIKRLRAKIDAPFSQKLLHTIRGMGYVLEPRATAHDGEGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-54 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-53 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator BAC0083 Protein 6e-59 59
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator BAC0125 Protein 3e-63 59
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator BAC0197 Protein 7e-61 58
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator BAC0111 Protein 6e-58 57
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator BAC0638 Protein 2e-53 55
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-52 53
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator BAC0308 Protein 4e-54 52

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-54 55
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator VFG1390 Protein 4e-40 43
Veis_0344 YP_995152.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-35 43