|
Name : rpmJ (BARBAKC583_0205) Accession : YP_988541.1 Strain : Bartonella bacilliformis KC583 Genome accession: NC_008783 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 208027 - 208152 bp Length : 126 bp Strand : - Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAAATTAAAAATTCGCTCAAGGCACTTAAGGGACGTCACCGCGACAACCGGGTGGTTCGTCGAAAAGGTCGTATTTA TATCTTGAATAAAACCAACCCGCGTTTTAGGGCGCGCCAAGGTTAA Protein sequence : MKIKNSLKALKGRHRDNRVVRRKGRIYILNKTNPRFRARQG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 2e-06 | 52 |
