Gene Information

Name : Ajs_1476 (Ajs_1476)
Accession : YP_985760.1
Strain : Acidovorax sp. JS42
Genome accession: NC_008782
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1532372 - 1532656 bp
Length : 285 bp
Strand : +
Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: neu:NE0841 mercury scavenger protein:heavy-metal-associated domain

DNA sequence :
ATGAAAAAACTCGTTGCTCTGGCCATGCTGGCCGCTTCTGCTTCGCCCCTCTGGGCTACCACGCAGAGTGTCACGCTGTC
CGTGCCCGACATGAACTGCGCCACCTGCCCGATCACAGTCAAGAAGGCGCTTACCAAGGTATCCGGCGTCAGCAAGATCG
ACGTGAATCTGGATCGGCGCGAGGCCAAGGTGACGTTCGACGATACGAAGGCGAATGTCGAGGTCCTCACACGCGCCACC
AGGAACGCAGGGTATCCCGCGACCGTGTTGGGAGACGCCAAGTGA

Protein sequence :
MKKLVALAMLAASASPLWATTQSVTLSVPDMNCATCPITVKKALTKVSGVSKIDVNLDRREAKVTFDDTKANVEVLTRAT
RNAGYPATVLGDAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ABQ57373.1 MerP Not tested SGI1 Protein 6e-20 70
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 6e-20 70
merP AFG30122.1 MerP Not tested PAGI-2 Protein 6e-20 70
merP AGK07023.1 MerP Not tested SGI1 Protein 6e-20 70
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 9e-20 70
merP AGK07081.1 MerP Not tested SGI1 Protein 6e-20 70
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 9e-19 67
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-18 67
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 1e-18 63
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 7e-19 62

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ajs_1476 YP_985760.1 mercuric transport protein periplasmic component BAC0679 Protein 9e-19 67
Ajs_1476 YP_985760.1 mercuric transport protein periplasmic component BAC0678 Protein 5e-19 64
Ajs_1476 YP_985760.1 mercuric transport protein periplasmic component BAC0231 Protein 5e-19 64
Ajs_1476 YP_985760.1 mercuric transport protein periplasmic component BAC0675 Protein 2e-17 60
Ajs_1476 YP_985760.1 mercuric transport protein periplasmic component BAC0674 Protein 8e-17 51