Name : Ajs_1299 (Ajs_1299) Accession : YP_985597.1 Strain : Acidovorax sp. JS42 Genome accession: NC_008782 Putative virulence/resistance : Resistance Product : mercuric transport protein periplasmic component Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1369895 - 1370182 bp Length : 288 bp Strand : - Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: rme:Rmet_2314 mercuric transport protein periplasmic component DNA sequence : ATGAAGAAACTCACCACCCTCACCACCCTCATCGCCCTGGCCGCCGCTCTAAGCGCGCCCGCCTGGGCTGCCACCAAGAC CGTCACCCTGTCGGTGCCCGGCATGACCTGCGCCGCGTGCCCGATCACGGTCAAGACGGCTCTGTCCAAGGTCGCCGGCG TCGAGAAGGCCGAAGTCAGCTTCGAGAAGCGGGAGGCCGTCGTCACCTTCGACGAGGCCAAGACCAATGCCGACGCCTTG ACCAAGGCCACCGCAAACGCGGGTTACCCGTCCAGCGTCAAGCAGTGA Protein sequence : MKKLTTLTTLIALAAALSAPAWAATKTVTLSVPGMTCAACPITVKTALSKVAGVEKAEVSFEKREAVVTFDEAKTNADAL TKATANAGYPSSVKQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 7e-26 | 100 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 2e-22 | 80 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-21 | 78 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 1e-21 | 78 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 1e-21 | 78 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 1e-21 | 78 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 1e-21 | 78 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 1e-21 | 78 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 2e-21 | 76 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 2e-21 | 76 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Ajs_1299 | YP_985597.1 | mercuric transport protein periplasmic component | BAC0678 | Protein | 3e-21 | 76 |
Ajs_1299 | YP_985597.1 | mercuric transport protein periplasmic component | BAC0679 | Protein | 5e-21 | 76 |
Ajs_1299 | YP_985597.1 | mercuric transport protein periplasmic component | BAC0231 | Protein | 2e-20 | 75 |
Ajs_1299 | YP_985597.1 | mercuric transport protein periplasmic component | BAC0675 | Protein | 4e-19 | 68 |
Ajs_1299 | YP_985597.1 | mercuric transport protein periplasmic component | BAC0674 | Protein | 2e-17 | 62 |