Gene Information

Name : Pnap_2586 (Pnap_2586)
Accession : YP_982810.1
Strain : Polaromonas naphthalenivorans CJ2
Genome accession: NC_008781
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 2720305 - 2720736 bp
Length : 432 bp
Strand : -
Note : TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related; KEGG: pol:Bpro_2219 arsenate reductase

DNA sequence : 
ATGTCCTTTGTGACGATCTATCACAACCCGAAATGCGGTACCTCGCGCAATGTGCTGGCGCTGATCCGCAACACTGGCGT
CGAGCCCGAGGTCATCGAGTATTTGAAGACGCCGCCCAGCCGGGAAACACTGGTCGAACTGATTGCCCGGATGGCCGTTC
CCGTGCGGGATGTGATGCGCGCCAAGGAAGCGCTCTACAGCGAGCTGGCGCTTGGCAACCCGGCGCTCGGCGACGACGCG
CTGATCGATGCGATGCTGGCCCATCCGATTTTGATCAACCGGCCCATCGTGGTGACGACGCTGGGCACACGCCTGTGCCG
CCCGTCCGAAGCAGTGCTCGACATCTTGCCGCTGCCGCAGCGCGCCGCCTTTGCCAAGGAAGACGGCGAGCCGGTCGTCA
ACGCACAGGGAGAGCGTGTTGCCGGACGCTAA

Protein sequence : 
MSFVTIYHNPKCGTSRNVLALIRNTGVEPEVIEYLKTPPSRETLVELIARMAVPVRDVMRAKEALYSELALGNPALGDDA
LIDAMLAHPILINRPIVVTTLGTRLCRPSEAVLDILPLPQRAAFAKEDGEPVVNAQGERVAGR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 4e-39 64
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 6e-40 60
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 6e-40 60
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 4e-40 60

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pnap_2586 YP_982810.1 arsenate reductase BAC0584 Protein 2e-41 65
Pnap_2586 YP_982810.1 arsenate reductase BAC0583 Protein 2e-41 64
Pnap_2586 YP_982810.1 arsenate reductase BAC0582 Protein 2e-40 62
Pnap_2586 YP_982810.1 arsenate reductase BAC0585 Protein 1e-40 61