Gene Information

Name : Pnap_4655 (Pnap_4655)
Accession : YP_973814.1
Strain :
Genome accession: NC_008760
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 42183 - 42758 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: eba:p1B315 protein involved in tellurite resistance

DNA sequence :
ATGGCCATCAGTCTACAAAAAGGCGGCAACGTCAATCTGAGCAAAGAAGCACCCTCACTCAAAAAACTAGTCATCGGGCT
CGGCTGGGATTCACGCGCCACGGACGGTGCTGCCTTCGATCTTGACGGAAGTGCCTTTCTATTGAAGGTGGATGGAAAGG
CTCGCTCCGACGCCGACTTCATCTTCTACAACAACTTGAAATCCACCGATGGCTCTGTCACCCACGCTGGCGACAACACA
AGCGGAACCGGTGAAGGAGACGATGAAAAACTCACTATCGACTTGGCCATGGTTCCAGCTGAAATCGAGAAAATAACCAT
TGGTGTAACGATTCACGACGCTGAAGCACGCAAGCAGAACTTTGGCATGGTCGGCAAGGCCTACATTCGTTGTCTCGACG
CCAATGGCGACAAGGAAATCGCACGCTACGACCTCTCCGAAGACAGTTCGACTGAGACGGCGATGATTTTTGGCGACATC
TATCGTGCTGGCGCTGAATGGAAATTCAAGGCTGTCGGACAAGGATTTGCAGGTGGTCTCGGCCCTCTGGCACGCTCTTT
CGGCATTGGCACTTAA

Protein sequence :
MAISLQKGGNVNLSKEAPSLKKLVIGLGWDSRATDGAAFDLDGSAFLLKVDGKARSDADFIFYNNLKSTDGSVTHAGDNT
SGTGEGDDEKLTIDLAMVPAEIEKITIGVTIHDAEARKQNFGMVGKAYIRCLDANGDKEIARYDLSEDSSTETAMIFGDI
YRAGAEWKFKAVGQGFAGGLGPLARSFGIGT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-55 63
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-62 63
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 62
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 61
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-54 61
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 9e-55 61
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-59 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pnap_4655 YP_973814.1 stress protein BAC0390 Protein 5e-58 62
Pnap_4655 YP_973814.1 stress protein BAC0389 Protein 2e-59 61