Gene Information

Name : Pnap_4654 (Pnap_4654)
Accession : YP_973813.1
Strain :
Genome accession: NC_008760
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 41568 - 42146 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: eba:p1B317 protein involved in tellurite resistance

DNA sequence :
ATGGCAATTAGTTTGCAAAAAGGCGGTAACGTCAACCTTTCGAAAACAGACCCCAATCTCAAGCAAGTGCTGCTTGGCCT
TGGATGGGATGCACGTTCTACAGATGGCGTGGATTTCGATCTAGATGCTAGTATTTTCATGGTCACTGAGAATGGCCGAG
TCCGTTCTGATAGCGATTTCATTTTTTATGGTCAGTTACGCTCACCCTGTGGTTCCATTGAGCACACCGGAGATAACCGC
ACTGGTGCTGGAGAAGGCGATGACGAGGGACTTAAGATAAAACTTGACCAAATTCCCTCCGTTATTACCCGGCTGGTGGT
AGCCGTTACTATTCATGATGCACAAGTACGTAAACAGAATTTCGGCATGGTGCATGACGCATTCATACGTCTAGTGAATA
TTGAAACCAATATCGAAATTACTCGATTTGATCTGTCGGAAGATTACTCAACTGAAACAGCCATGATTTTTGGCGAAATT
TACCGTTATGGCAGCGAATGGAAATTTAAAGCTGTCGGGCAAGGTTATGCGGGTGGTCTGAAAGCGCTTGCTATTCAGCA
TGGCGTTAATGTAAGTTAA

Protein sequence :
MAISLQKGGNVNLSKTDPNLKQVLLGLGWDARSTDGVDFDLDASIFMVTENGRVRSDSDFIFYGQLRSPCGSIEHTGDNR
TGAGEGDDEGLKIKLDQIPSVITRLVVAVTIHDAQVRKQNFGMVHDAFIRLVNIETNIEITRFDLSEDYSTETAMIFGEI
YRYGSEWKFKAVGQGYAGGLKALAIQHGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-61 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-60 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-57 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-57 64
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-57 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-59 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-56 61

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pnap_4654 YP_973813.1 stress protein BAC0390 Protein 3e-60 64
Pnap_4654 YP_973813.1 stress protein BAC0389 Protein 2e-60 64