Gene Information

Name : Maqu_0647 (Maqu_0647)
Accession : YP_957932.1
Strain : Marinobacter aquaeolei VT8
Genome accession: NC_008740
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 747286 - 747591 bp
Length : 306 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: tcx:Tcr_1853 transposase IS3/IS911

DNA sequence :
ATGGCGAAAACTAGAAACTTCAGTCCGGAATTCCGTTTGGAGGCTGCTCAATTGGTGGTCGACCAAGGATACACAGTGAA
AGCTGCCTGCGATGCCATGGGTGTCGGTAAATCCACCATGGAGTATTGGGTCCGTAAACTTCGTTCCGAACGGGCAGGCA
AAGCACCCAGAGGCGAGGCCCTGACCACAGAGCAGCGTGAGATTCAGGAACTGAAGCGCCGCCTTCGTCGGTCGGAGGAA
GAAAAGGAAATCTTAAAAAAGGCTACCGCTCTCTTGATGTCGGACTCCCTGAGCAATTCTCGATAA

Protein sequence :
MAKTRNFSPEFRLEAAQLVVDQGYTVKAACDAMGVGKSTMEYWVRKLRSERAGKAPRGEALTTEQREIQELKRRLRRSEE
EKEILKKATALLMSDSLSNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 5e-18 68
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-19 67
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 9e-19 67
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-19 67
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-19 67
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-19 67
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-19 67
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-19 67
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 6e-19 67
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 3e-17 63
l7045 CAD33744.1 - Not tested PAI I 536 Protein 3e-17 63
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-16 58
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 7e-17 58
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-14 56
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 4e-14 56
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 7e-16 52
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-16 52
unnamed AAC31483.1 L0004 Not tested LEE Protein 6e-16 52
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-16 52

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_0647 YP_957932.1 transposase IS3/IS911 family protein VFG1123 Protein 3e-19 67
Maqu_0647 YP_957932.1 transposase IS3/IS911 family protein VFG1485 Protein 1e-17 63
Maqu_0647 YP_957932.1 transposase IS3/IS911 family protein VFG1553 Protein 2e-14 56
Maqu_0647 YP_957932.1 transposase IS3/IS911 family protein VFG0784 Protein 2e-16 52