Gene Information

Name : Maqu_0238 (Maqu_0238)
Accession : YP_957531.1
Strain : Marinobacter aquaeolei VT8
Genome accession: NC_008740
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 280490 - 280915 bp
Length : 426 bp
Strand : -
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein, MerR; KEGG: ilo:IL1643 transcriptional regulator MerR

DNA sequence :
ATGTCCAAGAAACCACGTTCAATGACCATTGGCGCCCTGGCCAAGGCCGCCAATATCGGAGTGGAAACCATCCGCTATTA
CCAGCGCCGGGGACTGGTGGCAGAGCCTGACAAACCCTATGGAAGCATCCGCCATTACGACGATCAGGCGTTGGCGCGTC
TTCAGTTCATTCGAACGGCCCAATGGTTGGGCTTCAGCCTGGATGAAATCGGAGGACTGCTAACACTGCAAGACGGCACC
CATTGCGATGAAGCACGGGTACTGGGCGGACAGAAGCTCGCCAAGGTGCGTGAGAAAATTTCAAGTCTGCGGCGTATCGA
GCGAACGCTGGAGGGGCTGGTGCAGGCATGTTGCACTGAGCAGGGTGACGTGAAGTGCCCGCTCATTACGTCTCTTTATA
AGGGCGTAGAGGAAAACACGTCGTGA

Protein sequence :
MSKKPRSMTIGALAKAANIGVETIRYYQRRGLVAEPDKPYGSIRHYDDQALARLQFIRTAQWLGFSLDEIGGLLTLQDGT
HCDEARVLGGQKLAKVREKISSLRRIERTLEGLVQACCTEQGDVKCPLITSLYKGVEENTS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 5e-42 63
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-36 58
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-36 58
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-36 57
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-36 57
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-36 57
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-36 57
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-35 56
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-35 56
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 9e-36 51
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 6e-24 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_0238 YP_957531.1 MerR family transcriptional regulator BAC0686 Protein 1e-38 58
Maqu_0238 YP_957531.1 MerR family transcriptional regulator BAC0687 Protein 7e-37 57
Maqu_0238 YP_957531.1 MerR family transcriptional regulator BAC0684 Protein 1e-37 57
Maqu_0238 YP_957531.1 MerR family transcriptional regulator BAC0232 Protein 7e-37 57
Maqu_0238 YP_957531.1 MerR family transcriptional regulator BAC0688 Protein 3e-37 57
Maqu_0238 YP_957531.1 MerR family transcriptional regulator BAC0683 Protein 9e-38 57
Maqu_0238 YP_957531.1 MerR family transcriptional regulator BAC0689 Protein 3e-36 56