Gene Information

Name : Maqu_1393 (Maqu_1393)
Accession : YP_958667.1
Strain : Marinobacter aquaeolei VT8
Genome accession: NC_008740
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1574869 - 1575165 bp
Length : 297 bp
Strand : -
Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: net:Neut_2569 mercuric transport protein periplasmic component

DNA sequence :
ATGAAAATGCGCTTTGCCATGACGTTGCTTTTCGCCCTGCTCAGCATGCCCTCGTGGGCCGCCATGCAGACAGTGACGCT
TTCAGTTCCGGGGATGACCTGTTCCGCATGCCCCATTACCATCAAGCTGGCCTTGAACAAGGTGGACGGTGTTTCACAAG
TCGACGTGAGCTATCCGGATCGAGAAGCCGTGATTACCTTTGACGACACACGAACATCGGTGGAAGCCTTAACCCAGGCA
ACGGGCGATGTCGGCTATCCCTCCACCCTGAAATCCCTGGAAACGGACAGTAAGTGA

Protein sequence :
MKMRFAMTLLFALLSMPSWAAMQTVTLSVPGMTCSACPITIKLALNKVDGVSQVDVSYPDREAVITFDDTRTSVEALTQA
TGDVGYPSTLKSLETDSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07081.1 MerP Not tested SGI1 Protein 1e-20 70
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-20 70
merP ABQ57373.1 MerP Not tested SGI1 Protein 1e-20 70
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 1e-20 70
merP AFG30122.1 MerP Not tested PAGI-2 Protein 1e-20 70
merP AGK07023.1 MerP Not tested SGI1 Protein 1e-20 70
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-20 69
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-20 69
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-21 66
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 2e-19 63

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_1393 YP_958667.1 mercuric transport periplasmic protein BAC0679 Protein 2e-21 70
Maqu_1393 YP_958667.1 mercuric transport periplasmic protein BAC0231 Protein 2e-20 70
Maqu_1393 YP_958667.1 mercuric transport periplasmic protein BAC0678 Protein 1e-20 70
Maqu_1393 YP_958667.1 mercuric transport periplasmic protein BAC0675 Protein 9e-20 67
Maqu_1393 YP_958667.1 mercuric transport periplasmic protein BAC0674 Protein 1e-18 56