Gene Information

Name : Maqu_4014 (Maqu_4014)
Accession : YP_957203.1
Strain :
Genome accession: NC_008739
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 110525 - 110959 bp
Length : 435 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: regulatory protein, MerR; KEGG: net:Neut_2571 transcriptional regulator, MerR family

DNA sequence :
ATGTCGGTTAAAGCCAGTTCACTGACTATTGGCGGCTTGGCCAAGGCGGCCAATGTAAATGTCGAGACGATCCGCTATTA
CCAGCGGCGAGGTCTGTTGTCGGAACCCAAACGACCTCTAGGTGGTATTCGACGCTACGGTTCCGCCGATATTGATCGGC
TGACATTTGTTAAAACGGCGCAGCAGCTGGGTTTCAGTCTCGACGAGGTCGGCGACCTTTTAAGGTTGGAAGATGGCACT
CACTGTCAGGAAGCCAGTGCGCTCGCCGAGCACAAGCTGAAGGATGTGCGTGAAAAGATCGAAAGGCTGGTCAAAATTGA
GAAGGCTCTGAGCGACATGGTCAGTCAATGCCACGCACGGCCGGACAGCATCGCGTGCCCGCTCATTGCATCTCTACATG
AGGGAGACATTGGAACAAAAAGCCAAAGGGATTAG

Protein sequence :
MSVKASSLTIGGLAKAANVNVETIRYYQRRGLLSEPKRPLGGIRRYGSADIDRLTFVKTAQQLGFSLDEVGDLLRLEDGT
HCQEASALAEHKLKDVREKIERLVKIEKALSDMVSQCHARPDSIACPLIASLHEGDIGTKSQRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-44 66
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-44 66
merR ACK44535.1 MerR Not tested SGI1 Protein 8e-43 64
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 8e-43 64
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-42 64
merR AFG30124.1 MerR Not tested PAGI-2 Protein 8e-43 64
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-42 64
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-42 64
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-39 61
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 5e-40 60
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-27 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0688 Protein 6e-44 67
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0232 Protein 2e-43 65
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0687 Protein 2e-43 65
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0683 Protein 1e-43 64
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0684 Protein 5e-44 64
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0686 Protein 7e-43 64
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0689 Protein 2e-41 63
Maqu_4014 YP_957203.1 MerR family transcriptional regulator BAC0682 Protein 5e-22 41