Gene Information

Name : Mvan_0885 (Mvan_0885)
Accession : YP_951729.1
Strain : Mycobacterium vanbaalenii PYR-1
Genome accession: NC_008726
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 914501 - 915175 bp
Length : 675 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmc:Mmcs_0709 two component transcriptional regulator, winged helix family

DNA sequence :
GTGCTCATCGCCGACGACGACGACGTGGTACGCGACGTCGTGCGCCGTTACCTCGAGCGCGACGGGCTCGAAGTGTGCAC
CGCACCCAACGGTTCAGAGGCGCTGCGGCTGCTCGGCTCCCGGCGCATCGACGTCGCGGTGCTCGACGTGATGATGCCGG
GTCCCGACGGTATTGCACTGTGCCGCAACCTTCGTAAGGGCGGCGACTACTCCGTCCCGGTGATCCTGCTGACCGCCCTC
GGAGAGGAGCAGGACCGCATCGCCGGGCTGGAAGCCGGCGCCGACGACTACCTCACCAAACCGTTCAGCCCCCGCGAACT
GGCGCTGCGGGTGCGGTCGGTGTTGCGGCGCTCGCCGGCCACGGGCGGTGTGCTGCCCGTCGACATCAGGTCCGGGGACC
TGACCGTGACGACCGCGTCGCGCACGGTGACCATGGCCGGGACACCCGTGAGCCTCACCAACCGCGAATTCGACCTGCTG
CTGTTCTTCCTCACCCATCCCGACACCGTCTTCACTCGGGAGGATCTGCTCAAGCAGGTGTGGCTTTGGGACTTCGGTGA
CCTGTCGACGGTCACGGTGCACGTGAAGCGTCTGCGCTCGAAGCTCGGCGACCGGCATCGGGTGCAGACGGTGTGGGGTC
GCGGCTACATGTGGACCTCCGGTGCCGCCGGCTGA

Protein sequence :
MLIADDDDVVRDVVRRYLERDGLEVCTAPNGSEALRLLGSRRIDVAVLDVMMPGPDGIALCRNLRKGGDYSVPVILLTAL
GEEQDRIAGLEAGADDYLTKPFSPRELALRVRSVLRRSPATGGVLPVDIRSGDLTVTTASRTVTMAGTPVSLTNREFDLL
LFFLTHPDTVFTREDLLKQVWLWDFGDLSTVTVHVKRLRSKLGDRHRVQTVWGRGYMWTSGAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 7e-24 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 7e-24 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 7e-24 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 7e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-29 43
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-29 42
Mvan_0885 YP_951729.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-28 42
Mvan_0885 YP_951729.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-30 41
Mvan_0885 YP_951729.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mvan_0885 YP_951729.1 two component transcriptional regulator VFG1389 Protein 6e-25 44
Mvan_0885 YP_951729.1 two component transcriptional regulator VFG1386 Protein 6e-24 42
Mvan_0885 YP_951729.1 two component transcriptional regulator VFG1390 Protein 6e-26 41