Name : rpsN (Mvan_5491) Accession : YP_956266.1 Strain : Mycobacterium vanbaalenii PYR-1 Genome accession: NC_008726 Putative virulence/resistance : Unknown Product : 30S ribosomal protein S14 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0199 EC number : - Position : 5873525 - 5873830 bp Length : 306 bp Strand : + Note : located in the peptidyl transferase center and involved in assembly of 30S ribosome subunit; similar to what is observed with proteins L31 and L33, some proteins in this family contain CXXC motifs that are involved in zinc binding; if two copies are prese DNA sequence : ATGGCCAAGAAGTCCAAGATCGTGCAGAACGAGCGGCGCCGCGAGATCGTGGCCCGCCACGCCGAGCGCAGGGCCGAGTT GAAGGCGATCATCAAGTCGCCGTCGACGACGCCCGAGGCTCGGGTGGCGGCACAGTCGGAGCTCAACCGCCAGCCCCGCG ACGCGAGCCCCGTGCGGGTCCGCAACCGCGACTCCGTCGACGGCCGACCACGCGGCCATCTGCGCAAGTTCGGGCTGTCG CGGGTACGGGTCCGCGAACTCGCTCACCAGGGCCAGCTGCCCGGCGTCCGGAAGTCGAGCTGGTGA Protein sequence : MAKKSKIVQNERRREIVARHAERRAELKAIIKSPSTTPEARVAAQSELNRQPRDASPVRVRNRDSVDGRPRGHLRKFGLS RVRVRELAHQGQLPGVRKSSW |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ef0103 | AAM75306.1 | EF0103 | Not tested | Not named | Protein | 2e-16 | 46 |
rpsN | NP_814350.1 | 30S ribosomal protein S14 | Not tested | Not named | Protein | 3e-16 | 46 |