Gene Information

Name : Mvan_4844 (Mvan_4844)
Accession : YP_955623.1
Strain : Mycobacterium vanbaalenii PYR-1
Genome accession: NC_008726
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5181295 - 5181990 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmc:Mmcs_4301 two component transcriptional regulator, winged helix family

DNA sequence : 
GTGCCAGTGCGCATTCTTGTCGTTGATGACGATCGCGCGGTGCGCGAATCCCTGCGCCGCTCGCTGTCGTTCAATGGTTA
TTCGGTGGAGCTGGCCCAGGACGGCCGCGAAGCTCTCGACCTGATAGCCAGCGATCGGCCCGACGCGGTCGTGCTCGACG
TGATGATGCCCAGGCTCGACGGCCTCGAGGTCTGCCGCCAGCTCCGCAGCACCGGTGACGACCTTCCGATCCTGGTTCTG
ACCGCGCGTGATTCGGTGTCAGAGCGGGTCGCCGGTCTGGACGCCGGGGCCGACGACTACCTGCCGAAGCCGTTCGCGCT
GGAAGAGTTGCTCGCCCGGATGCGCGCGTTGCTGCGTCGCACCACCCCCGACGACGGGGCCGGCGAGTCGGCGGCGATGA
CGTTCTCGGACCTGTCCCTGGACCCCGTCACCCGAGAGGTGACCCGCGGCGACCGGCCGATCAGCCTGACCCGCACCGAG
TTCTCGCTGCTGGAGATGCTGATCGCCAACCCACGGCGGGTGTTGACCCGAAGCAGGATTCTGGAAGAGGTGTGGGGCTT
CGACTTCCCCACATCGGGCAACGCTCTCGAGGTCTACGTCGGCTATCTGCGCAGAAAGACCGAGGCAGAAGGCGAGCCGC
GGCTCATCCACACGGTGCGGGGCGTGGGATACGTGCTGCGTGAGACACCGCCCTGA

Protein sequence : 
MPVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGREALDLIASDRPDAVVLDVMMPRLDGLEVCRQLRSTGDDLPILVL
TARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTTPDDGAGESAAMTFSDLSLDPVTREVTRGDRPISLTRTE
FSLLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYVGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-34 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mvan_4844 YP_955623.1 two component transcriptional regulator BAC0125 Protein 2e-33 44
Mvan_4844 YP_955623.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-40 44
Mvan_4844 YP_955623.1 two component transcriptional regulator BAC0083 Protein 8e-33 44
Mvan_4844 YP_955623.1 two component transcriptional regulator BAC0638 Protein 1e-28 44
Mvan_4844 YP_955623.1 two component transcriptional regulator BAC0308 Protein 3e-34 43
Mvan_4844 YP_955623.1 two component transcriptional regulator BAC0111 Protein 8e-35 43
Mvan_4844 YP_955623.1 two component transcriptional regulator BAC0347 Protein 8e-30 42
Mvan_4844 YP_955623.1 two component transcriptional regulator AE000516.2.gene3505. Protein 5e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mvan_4844 YP_955623.1 two component transcriptional regulator VFG1390 Protein 2e-86 93
Mvan_4844 YP_955623.1 two component transcriptional regulator VFG1386 Protein 2e-45 51
Mvan_4844 YP_955623.1 two component transcriptional regulator VFG1389 Protein 1e-41 50
Mvan_4844 YP_955623.1 two component transcriptional regulator VFG0596 Protein 3e-34 42