Gene Information

Name : Mvan_1752 (Mvan_1752)
Accession : YP_952581.1
Strain : Mycobacterium vanbaalenii PYR-1
Genome accession: NC_008726
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1859149 - 1859835 bp
Length : 687 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmc:Mmcs_1347 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGACACCATGAGGCAAAGGATCCTGGTAGTCGACGACGACCCTTCGCTCGCCGAGATGCTCACCATCGTGCTGCGCGG
GGAGGGATTCGACACCGCGGTCATCGGTGACGGCACCCAGGCGTTGACCGCCGTGCGCGAGCTGCGGCCCGATCTGGTGC
TGCTCGATCTCATGCTGCCCGGCATGAACGGCATCGATGTGTGCCGTGTGCTGCGTGCGGACTCCGGCGTGCCGATCGTG
ATGCTGACCGCCAAGACCGACACCGTCGACGTGGTGCTGGGCCTGGAGTCCGGCGCCGACGACTACGTGATGAAGCCGTT
CAAACCCAAGGAACTGGTGGCCCGCGTGCGCGCCCGGCTGCGGCGCAACGAGGACGAGCCGGCCGAGATGCTGTCGATCG
CCGACATCGACATCGACGTCCCGGCCCACAAGGTCACCCGGCAGGGCGAACAGATCTCGCTCACGCCGCTGGAGTTCGAC
CTGCTGGTGGCGCTGGCACGGAAACCGCGCCAGGTGTTTACTCGTGATGTGCTGCTCGAACAGGTGTGGGGTTACCGCCA
CCCCGCGGACACCCGTTTGGTGAACGTGCATGTCCAGCGACTGCGGGCCAAGGTTGAGAAAGACCCGGAGAACCCGCAGG
TGGTGCTGACCGTTCGAGGAGTGGGATACAAGGCCGGACCTCCGTGA

Protein sequence :
MDTMRQRILVVDDDPSLAEMLTIVLRGEGFDTAVIGDGTQALTAVRELRPDLVLLDLMLPGMNGIDVCRVLRADSGVPIV
MLTAKTDTVDVVLGLESGADDYVMKPFKPKELVARVRARLRRNEDEPAEMLSIADIDIDVPAHKVTRQGEQISLTPLEFD
LLVALARKPRQVFTRDVLLEQVWGYRHPADTRLVNVHVQRLRAKVEKDPENPQVVLTVRGVGYKAGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mvan_1752 YP_952581.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-85 97
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-37 46
Mvan_1752 YP_952581.1 two component transcriptional regulator HE999704.1.gene2815. Protein 9e-31 44
Mvan_1752 YP_952581.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-25 43
Mvan_1752 YP_952581.1 two component transcriptional regulator BAC0125 Protein 6e-26 43
Mvan_1752 YP_952581.1 two component transcriptional regulator BAC0111 Protein 4e-22 42
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-31 42
Mvan_1752 YP_952581.1 two component transcriptional regulator BAC0197 Protein 2e-24 42
Mvan_1752 YP_952581.1 two component transcriptional regulator CP000034.1.gene2186. Protein 1e-26 42
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_002695.1.916589.p Protein 1e-26 42
Mvan_1752 YP_952581.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-26 42
Mvan_1752 YP_952581.1 two component transcriptional regulator BAC0039 Protein 1e-26 42
Mvan_1752 YP_952581.1 two component transcriptional regulator BAC0347 Protein 6e-18 41
Mvan_1752 YP_952581.1 two component transcriptional regulator NC_012469.1.7686381. Protein 4e-33 41
Mvan_1752 YP_952581.1 two component transcriptional regulator CP004022.1.gene1676. Protein 2e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mvan_1752 YP_952581.1 two component transcriptional regulator VFG1390 Protein 3e-27 43
Mvan_1752 YP_952581.1 two component transcriptional regulator VFG1389 Protein 1e-23 42
Mvan_1752 YP_952581.1 two component transcriptional regulator VFG1702 Protein 3e-29 41
Mvan_1752 YP_952581.1 two component transcriptional regulator VFG1386 Protein 1e-23 41