
|
Name : rpmJ (AAur_2879) Accession : YP_948588.1 Strain : Arthrobacter aurescens TC1 Genome accession: NC_008711 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 3159043 - 3159165 bp Length : 123 bp Strand : - Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : ATGAAGGTCAGGAATTCGCTGCGTGCCCTCAAGAAGATCCCCGGTGCGCAGATTGTCCGCAGGCGTGGACGGACGTTCGT CATCAACAAGAACAACCCACGGATGAAGGCGCGGCAGGGCTAA Protein sequence : MKVRNSLRALKKIPGAQIVRRRGRTFVINKNNPRMKARQG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 7e-09 | 70 |