Gene Information

Name : AAur_1575 (AAur_1575)
Accession : YP_947342.1
Strain : Arthrobacter aurescens TC1
Genome accession: NC_008711
Putative virulence/resistance : Resistance
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1721257 - 1722081 bp
Length : 825 bp
Strand : +
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
GTGCCCTTTGTGCCAGGATCGGGTGCCGGCCACCCCCAGCAAACCTATGCTGAAAGTGTGACCACAAATACGGCATCATC
TGCACCAGGGAATCGTCGCATTCTTCTGGTAGAGGATGAACAGACCATTGCCGACGTTGTCCGCGACTACCTGCTGAAGG
CCGGGTTCCAAGTGGACATGGCGGGGGACGGCTTCACCGCCCTCGAGCTGGCAGCCTCTCGTCAACCCGACCTTGTGATC
CTGGACCGCATGCTGCCAGGACTGGACGGTGTGGAGGTCTGCCGCCGACTCCGCCAAACCATGAGCGTTCCCGTCATCAT
GGTCACGGCTCTGGGAACCGAAGACGACCGGATTCTGGGCTTGGAAATGGGAGCGGATGATTACGTCACCAAACCCTTCT
CTCCGCGGGAGCTGGTCCTCCGGGTTAAATCGGTACTGCGCCGGAGCATCAAGGAATTCGCGCCGGAACCGCCTGTGGAG
GCCGCAGGACTTGAACTGGATCCTGCCTCCCGGACAGTCACGCACGGCGGAGTTCCGCTGGCGCTGACGGTCCGTGAATT
CGACCTCCTGGCTTTCATGATGCGAAGGCCCAACCAAGTTTTCAGCCGGGAAGAATTGATCAAGGCCGTCTGGGGCTGGG
ACTTCGGCGATCTGTCCACAGTCACGGTCCACGTCCGGCGCCTGCGGGAGAAAATCGAAGCCAACCCCACCAAACCCGAA
CTGCTCAAGACCGTATGGGGCGTCGGCTACCGCTTCGACAGCAAGCGATCCGATGGCGTCACTATGAACGTGCACGGCAA
AGAGGGTGAGCATGGAAGGCAGTGA

Protein sequence :
MPFVPGSGAGHPQQTYAESVTTNTASSAPGNRRILLVEDEQTIADVVRDYLLKAGFQVDMAGDGFTALELAASRQPDLVI
LDRMLPGLDGVEVCRRLRQTMSVPVIMVTALGTEDDRILGLEMGADDYVTKPFSPRELVLRVKSVLRRSIKEFAPEPPVE
AAGLELDPASRTVTHGGVPLALTVREFDLLAFMMRRPNQVFSREELIKAVWGWDFGDLSTVTVHVRRLREKIEANPTKPE
LLKTVWGVGYRFDSKRSDGVTMNVHGKEGEHGRQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-37 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-34 42
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-32 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AAur_1575 YP_947342.1 two-component system response regulator NC_012469.1.7685629. Protein 4e-44 48
AAur_1575 YP_947342.1 two-component system response regulator AE000516.2.gene3505. Protein 3e-39 46
AAur_1575 YP_947342.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-43 45
AAur_1575 YP_947342.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_002952.2859905.p0 Protein 3e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_007622.3794472.p0 Protein 2e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-45 44
AAur_1575 YP_947342.1 two-component system response regulator NC_012469.1.7686381. Protein 2e-44 44
AAur_1575 YP_947342.1 two-component system response regulator BAC0197 Protein 1e-32 43
AAur_1575 YP_947342.1 two-component system response regulator NC_011595.7057856.p0 Protein 2e-37 43
AAur_1575 YP_947342.1 two-component system response regulator NC_010410.6002989.p0 Protein 2e-37 43
AAur_1575 YP_947342.1 two-component system response regulator AF162694.1.orf4.gene Protein 3e-34 43
AAur_1575 YP_947342.1 two-component system response regulator NC_010400.5986590.p0 Protein 8e-37 42
AAur_1575 YP_947342.1 two-component system response regulator BAC0347 Protein 2e-34 42
AAur_1575 YP_947342.1 two-component system response regulator AF155139.2.orf0.gene Protein 1e-39 42
AAur_1575 YP_947342.1 two-component system response regulator FJ349556.1.orf0.gene Protein 3e-38 42
AAur_1575 YP_947342.1 two-component system response regulator AF310956.2.orf0.gene Protein 5e-33 41
AAur_1575 YP_947342.1 two-component system response regulator AF130997.1.orf0.gene Protein 1e-33 41
AAur_1575 YP_947342.1 two-component system response regulator AE016830.1.gene1681. Protein 7e-42 41
AAur_1575 YP_947342.1 two-component system response regulator EU250284.1.orf4.gene Protein 5e-34 41
AAur_1575 YP_947342.1 two-component system response regulator CP000675.2.gene1535. Protein 1e-38 41
AAur_1575 YP_947342.1 two-component system response regulator BAC0111 Protein 5e-37 41
AAur_1575 YP_947342.1 two-component system response regulator HE999704.1.gene1528. Protein 6e-29 41
AAur_1575 YP_947342.1 two-component system response regulator BAC0638 Protein 5e-25 41
AAur_1575 YP_947342.1 two-component system response regulator NC_009085.4919120.p0 Protein 7e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AAur_1575 YP_947342.1 two-component system response regulator VFG1389 Protein 4e-29 44
AAur_1575 YP_947342.1 two-component system response regulator VFG1563 Protein 2e-38 43
AAur_1575 YP_947342.1 two-component system response regulator VFG1702 Protein 1e-37 43
AAur_1575 YP_947342.1 two-component system response regulator VFG0596 Protein 8e-35 42
AAur_1575 YP_947342.1 two-component system response regulator VFG1390 Protein 3e-35 42