Gene Information

Name : Ping_2575 (Ping_2575)
Accession : YP_943895.1
Strain : Psychromonas ingrahamii 37
Genome accession: NC_008709
Putative virulence/resistance : Resistance
Product : stress protein, tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3157953 - 3158528 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: eba:p1B315 protein involved in tellurite resistance

DNA sequence :
ATGGCAGTTTCTCTACAAAAAGGTGGAAATGTTTCACTGGATAAAGTTGCGCCAGGTATGACTAAATGTTTGCTTGGTTT
AGGTTGGGATGCAAGAAGTACTGACGGAATTGATTTTGACTTAGATGCATCAGGCTTTATGGTTAATACAGAAGGTAAAG
TACTTTCAGACAAAGGTTTTATTTTTTACGGTAACGTACTTTCTGAATGTGGTTCTGTTGAGCATACGGGGGATAACTTA
ACTGGCGAGGGTGATGGCGATGACGAAGTGATTAAAGTTGATTTAAGCAAAGTCCCTGCTGATGTTGAAAAAATTGTTGT
TGGTGTGACTATTCACGAAGCTGAATCACGTAAGCAAAATTTTGGCCAAGTTTCTAATGCTTTCATCCGCGTTGTAAATG
ATGCAAACAAAGAAGAAGTTGCCCGTTACGATTTATCCGAAGACTATTCTATTGAAACTGCACTACTTTTTGGTGAATTG
TATCGCCATAATGGTACGTGGAAGTTTAAAGCAATTGGTCAAGGTTTTGCGGGTGGCTTAAAAGCGATGGCGCAACAATT
TAACGTTAATGTTTAA

Protein sequence :
MAVSLQKGGNVSLDKVAPGMTKCLLGLGWDARSTDGIDFDLDASGFMVNTEGKVLSDKGFIFYGNVLSECGSVEHTGDNL
TGEGDGDDEVIKVDLSKVPADVEKIVVGVTIHEAESRKQNFGQVSNAFIRVVNDANKEEVARYDLSEDYSIETALLFGEL
YRHNGTWKFKAIGQGFAGGLKAMAQQFNVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 67
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-54 67
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-54 67
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-60 66
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-59 66
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-58 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-55 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-23 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ping_2575 YP_943895.1 stress protein, tellurium resistance protein BAC0390 Protein 4e-58 68
Ping_2575 YP_943895.1 stress protein, tellurium resistance protein BAC0389 Protein 1e-58 66
Ping_2575 YP_943895.1 stress protein, tellurium resistance protein BAC0392 Protein 1e-23 41