Gene Information

Name : ragA (azo0457)
Accession : YP_931961.1
Strain : Azoarcus sp. BH72
Genome accession: NC_008702
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 488198 - 488884 bp
Length : 687 bp
Strand : +
Note : Response regulator,; High confidence in function and specificity

DNA sequence : 
ATGAAGATCCTGCTCGTCGAAGACGACGCCCAACAGGCGGGCTACATCCGCAAGGGCCTGCAGGAAGCCGGCCACACGGT
CGATGTCGCCGCCGACGGCCGCGACGGGCTCTTTCTCGCCACCACCGCCAGCTTCGATGCGATCGTGCTTGACCGCATGC
TGCCGCGCGTGGACGGCCTCACCGTGCTGCGCACGCTGCGGGCCTCTCGGATAGCGACCCCGGTGGTGGTGCTGTCCGCG
CTCGGCGAGGTGGACGACCGCGTCGCCGGGCTGCGCGCCGGCAGCGACGACTATCTGGTCAAGCCCTTCGCGTTGTCCGA
ACTGCTCGCGCGGCTGGACGCGCTGCAGCGGCGCGGCAACGGCCGCGCGGAAGCGGAGCAGACCCGGCTGCAGACCGCCG
ACCTCGAGATGGACCTGCTGCGGCGCAGTGTCAGCCGCGGCGCCACCCGCATCGAACTCAAGCCGAAGGAGTTCCGTCTG
CTCGAATTCCTGCTGCGCCATTCCGGCCAGGTGGTCACCCGCAGCATGCTGCTGGAGGCGGTGTGGGACTACCACTTCGA
CCCCCAGACCAACGTCATCGACGTGCACATCTCCAACCTGCGCGCCAAGATCGACCTGCCCGGGCTGCCGCCGCTGATCC
ACACCGTGCGTGGTGCCGGCTACCGGCTGGGCGGCGATGCCGCGTGA

Protein sequence : 
MKILLVEDDAQQAGYIRKGLQEAGHTVDVAADGRDGLFLATTASFDAIVLDRMLPRVDGLTVLRTLRASRIATPVVVLSA
LGEVDDRVAGLRAGSDDYLVKPFALSELLARLDALQRRGNGRAEAEQTRLQTADLEMDLLRRSVSRGATRIELKPKEFRL
LEFLLRHSGQVVTRSMLLEAVWDYHFDPQTNVIDVHISNLRAKIDLPGLPPLIHTVRGAGYRLGGDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-44 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-43 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ragA YP_931961.1 two-component response regulator BAC0111 Protein 3e-52 52
ragA YP_931961.1 two-component response regulator BAC0347 Protein 8e-47 51
ragA YP_931961.1 two-component response regulator BAC0125 Protein 8e-49 50
ragA YP_931961.1 two-component response regulator BAC0083 Protein 2e-46 49
ragA YP_931961.1 two-component response regulator BAC0197 Protein 1e-42 49
ragA YP_931961.1 two-component response regulator BAC0638 Protein 2e-38 47
ragA YP_931961.1 two-component response regulator BAC0308 Protein 6e-43 46
ragA YP_931961.1 two-component response regulator HE999704.1.gene1528. Protein 3e-33 45
ragA YP_931961.1 two-component response regulator CP004022.1.gene3215. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ragA YP_931961.1 two-component response regulator VFG0596 Protein 2e-44 48
ragA YP_931961.1 two-component response regulator VFG1390 Protein 1e-42 47
ragA YP_931961.1 two-component response regulator VFG1389 Protein 2e-37 47