Gene Information

Name : copR (azo2946)
Accession : YP_934449.1
Strain : Azoarcus sp. BH72
Genome accession: NC_008702
Putative virulence/resistance : Virulence
Product : two component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3233236 - 3233916 bp
Length : 681 bp
Strand : -
Note : Transcriptional activator protein,; High confidence in function and specificity

DNA sequence :
GTGAAGATCCTGATCGTCGAGGACGAGCCCAAGACCGGCGACTACCTGCGCCAGGGGTTGGCCGAGGCGGGCTTCGTCGT
CGATCTGGCGCGCGACGGCCTGGACGGCCTGCACCTTGCGCTCGGCGGCGACTACGACCTTGTGGTGCTCGATGTGATGC
TGCCTTCGCTCGACGGCTGGGGCGTGCTGCAGACCGTGCGCCGCGCCGGCCACGAGATGCCGGTGCTGTTCCTGACCGCG
CGCGATCAGGTCGAGGACCGTGTGCGCGGGCTTGAACTCGGCGCTGACGACTACCTGGTCAAGCCCTTCGCCTTCTCCGA
ACTGCTCGCCCGGGTGCGGACCCTGTTGCGCCGTGGCAAGGCCAAGGAGGCCGAAGTGCTGCGCGCGGCCGACCTCGAAC
TGGACCTGCTGCGCCGGCGGGTGGTCCGCGGCGGCCAGCGCATCGACCTCACCGCCAAGGAATTCGCTCTGCTCGAACTG
CTGCTGCGCCGCCAGGGCGAGGTGCTGCCGCGCTCGCTGATCGCTTCGCAGGTGTGGGACATGAATTTCGACAGCGACAC
CAACGTCATCGAGGTGGCGGTGCGCCGGTTGCGCGCGAAGGTGGACGACAGCTTCGAACCCAAGCTGATCCGCACTGTGC
GCGGGATGGGTTACGTGCTGGAGGCGCCGGGGGCGGCATGA

Protein sequence :
MKILIVEDEPKTGDYLRQGLAEAGFVVDLARDGLDGLHLALGGDYDLVVLDVMLPSLDGWGVLQTVRRAGHEMPVLFLTA
RDQVEDRVRGLELGADDYLVKPFAFSELLARVRTLLRRGKAKEAEVLRAADLELDLLRRRVVRGGQRIDLTAKEFALLEL
LLRRQGEVLPRSLIASQVWDMNFDSDTNVIEVAVRRLRAKVDDSFEPKLIRTVRGMGYVLEAPGAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-48 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-47 59

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_934449.1 two component response regulator BAC0638 Protein 6e-55 72
copR YP_934449.1 two component response regulator BAC0083 Protein 4e-61 70
copR YP_934449.1 two component response regulator BAC0197 Protein 2e-58 70
copR YP_934449.1 two component response regulator BAC0111 Protein 2e-58 68
copR YP_934449.1 two component response regulator BAC0308 Protein 8e-59 67
copR YP_934449.1 two component response regulator BAC0125 Protein 2e-56 65
copR YP_934449.1 two component response regulator BAC0347 Protein 5e-52 61
copR YP_934449.1 two component response regulator HE999704.1.gene1528. Protein 2e-19 43
copR YP_934449.1 two component response regulator AE000516.2.gene3505. Protein 1e-19 42
copR YP_934449.1 two component response regulator NC_002516.2.879194.p Protein 5e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copR YP_934449.1 two component response regulator VFG0596 Protein 3e-48 60
copR YP_934449.1 two component response regulator VFG1390 Protein 5e-35 49
copR YP_934449.1 two component response regulator VFG1389 Protein 2e-28 44
copR YP_934449.1 two component response regulator VFG0473 Protein 6e-25 41