
|
Name : copZ (azo1356) Accession : YP_932860.1 Strain : Azoarcus sp. BH72 Genome accession: NC_008702 Putative virulence/resistance : Resistance Product : copper chaperon Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1474902 - 1475111 bp Length : 210 bp Strand : + Note : Conserved hypothetical copper chaperon. Homology to copZ of copZ Azoarcus sp. EbN1 of 66%. Pfam: Heavy-metal-associated domain. Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures. Tigrf DNA sequence : ATGGAAGAAGTGACGCTGAAAGTCGAAGGGATGAGCTGCGGTGGCTGTGTGCGCAACGTCACCGGCGTATTGAAGGCGCT GCCGGGCGTCAGTGAAGCGGATGTATCGCTTGACGCGGCGCAGGCGCGGGTCCGGTTCGATCCGGCGCGGGTGAGCGTGG CCGAATTGCGTCAGGCCGTGGAGGGCGCGGGCTTCGATTCCCCCGCCTGA Protein sequence : MEEVTLKVEGMSCGGCVRNVTGVLKALPGVSEADVSLDAAQARVRFDPARVSVAELRQAVEGAGFDSPA |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 3e-08 | 45 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 2e-08 | 45 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| copZ | YP_932860.1 | copper chaperon | BAC0678 | Protein | 4e-08 | 41 |