Gene Information

Name : copZ (azo1356)
Accession : YP_932860.1
Strain : Azoarcus sp. BH72
Genome accession: NC_008702
Putative virulence/resistance : Resistance
Product : copper chaperon
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1474902 - 1475111 bp
Length : 210 bp
Strand : +
Note : Conserved hypothetical copper chaperon. Homology to copZ of copZ Azoarcus sp. EbN1 of 66%. Pfam: Heavy-metal-associated domain. Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures. Tigrf

DNA sequence :
ATGGAAGAAGTGACGCTGAAAGTCGAAGGGATGAGCTGCGGTGGCTGTGTGCGCAACGTCACCGGCGTATTGAAGGCGCT
GCCGGGCGTCAGTGAAGCGGATGTATCGCTTGACGCGGCGCAGGCGCGGGTCCGGTTCGATCCGGCGCGGGTGAGCGTGG
CCGAATTGCGTCAGGCCGTGGAGGGCGCGGGCTTCGATTCCCCCGCCTGA

Protein sequence :
MEEVTLKVEGMSCGGCVRNVTGVLKALPGVSEADVSLDAAQARVRFDPARVSVAELRQAVEGAGFDSPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 3e-08 45
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 2e-08 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copZ YP_932860.1 copper chaperon BAC0678 Protein 4e-08 41