Gene Information

Name : copZ (azo1356)
Accession : YP_932860.1
Strain : Azoarcus sp. BH72
Genome accession: NC_008702
Putative virulence/resistance : Resistance
Product : copper chaperon
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1474902 - 1475111 bp
Length : 210 bp
Strand : +
Note : Conserved hypothetical copper chaperon. Homology to copZ of copZ Azoarcus sp. EbN1 of 66%. Pfam: Heavy-metal-associated domain. Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures. Tigrf

DNA sequence :

ATGGAAGAAGTGACGCTGAAAGTCGAAGGGATGAGCTGCGGTGGCTGTGTGCGCAACGTCACCGGCGTATTGAAGGCGCT
GCCGGGCGTCAGTGAAGCGGATGTATCGCTTGACGCGGCGCAGGCGCGGGTCCGGTTCGATCCGGCGCGGGTGAGCGTGG
CCGAATTGCGTCAGGCCGTGGAGGGCGCGGGCTTCGATTCCCCCGCCTGA

Protein sequence :

MEEVTLKVEGMSCGGCVRNVTGVLKALPGVSEADVSLDAAQARVRFDPARVSVAELRQAVEGAGFDSPA

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
merP	CAJ77062.1	Periplasmic mercuric ion binding protein	Not tested	AbaR1	Protein	2e-08	45
merP	ACN81007.1	MerP periplasmic mercuric ion binding protein	Not tested	AbaR5	Protein	3e-08	45

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
copZ	YP_932860.1	copper chaperon	BAC0678	Protein	4e-08	41