Gene Information

Name : copY (azo1354)
Accession : YP_932858.1
Strain : Azoarcus sp. BH72
Genome accession: NC_008702
Putative virulence/resistance : Resistance
Product : putative regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 1471968 - 1472363 bp
Length : 396 bp
Strand : -
Note : Heavy metal dependent transcription regulator 2. TRANSCRIPTIONAL REGULATOR INVOLVED IN ACID TOLERANCE. BINDS COPPER (By similarity). It contains a n-terminal dna binding region and a c- terminal metal binding region (by similarity). 35% HTH_MerR.IPR009061

DNA sequence :
ATGGACCACACTTACACGATAGGGCAGCTTGCCGCGCAGGCCGAGGTCGGGGTCGAGACGATCCGCTACTACCACCGCAG
GGGACTGCTGGCGGAACCCGAACGCCGGGGCAGCTACCGGGCGTATCAGGAGGACGACCTCGAACGATTGAAGGCGATCC
GCCGCGCGCAACAGCTCGGCTTCTCGCTCGAGGAAATCGACGAGTTACTGGGATTGAACGAAGAACGCGACCGCGAGAAG
GCGCGCCGGATTGCGCAGGGGAAGATCGACGATATCGAGGTGCGTATCCGCCAACTGGAGGAGATGCGCGGCGCGCTACG
TGCCTTGGTGAAGTGCTGCCGGGACACCGAGGCACCGGCGCCCTGCCCCATTCTCAAGTCGCTGGCGGGAAAGTAG

Protein sequence :
MDHTYTIGQLAAQAEVGVETIRYYHRRGLLAEPERRGSYRAYQEDDLERLKAIRRAQQLGFSLEEIDELLGLNEERDREK
ARRIAQGKIDDIEVRIRQLEEMRGALRALVKCCRDTEAPAPCPILKSLAGK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merR AGK07083.1 MerR Not tested SGI1 Protein 1e-20 44
merR ACK44535.1 MerR Not tested SGI1 Protein 6e-21 44
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 6e-21 44
merR AFG30124.1 MerR Not tested PAGI-2 Protein 6e-21 44
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 9e-21 44
merR AGK07025.1 MerR Not tested SGI1 Protein 1e-20 44
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 9e-21 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-20 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
copY YP_932858.1 putative regulatory protein BAC0683 Protein 2e-22 44
copY YP_932858.1 putative regulatory protein BAC0688 Protein 4e-22 43
copY YP_932858.1 putative regulatory protein BAC0687 Protein 4e-21 43
copY YP_932858.1 putative regulatory protein BAC0684 Protein 5e-22 43
copY YP_932858.1 putative regulatory protein BAC0686 Protein 3e-22 43
copY YP_932858.1 putative regulatory protein BAC0232 Protein 4e-21 43
copY YP_932858.1 putative regulatory protein BAC0689 Protein 3e-20 43
copY YP_932858.1 putative regulatory protein BAC0569 Protein 4e-19 42
copY YP_932858.1 putative regulatory protein BAC0682 Protein 2e-18 41
copY YP_932858.1 putative regulatory protein BAC0462 Protein 2e-21 41
copY YP_932858.1 putative regulatory protein BAC0182 Protein 8e-23 41