Gene Information

Name : Noca_2062 (Noca_2062)
Accession : YP_923258.1
Strain : Nocardioides sp. JS614
Genome accession: NC_008699
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2205939 - 2206625 bp
Length : 687 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: fra:Francci3_2401 two component transcriptional regulator, winged helix family

DNA sequence : 
GTGAGGATCCTGGTGGCCGAGGACGACGTCCGCCTCGCCGACGTCCTCGAGGAGTCCCTGGCCGAGGCCGGGTGGCAGGT
CGAGGTGGCGCACGACGGCCGCTCGGCGTACGAGCGGCTGCTCTCCGACTCCAGCCTGGACGTGGCGCTGCTCGACTGGA
TGCTGCCGGGCCTGGACGGGGTGACCGTGGCCCGGCGGCTGCGCGACCTGGGCGTCGCGCTGCCGATCCTGATGCTCACG
GCCCGTGGTGACGTCCGCGACCGGGTCAGCGGCCTGGACGCCGGCGCCGACGACTACCTGCCCAAGCCGTTCGACCTCGA
CGAGCTGCTGGCCCGGCTGCGCGCGCTCTACCGCCGCGGCAGCCTGGTGGGCGAGGCGCCCGTGCAGCTCGGCGACCTGG
TCGTGGACCCGGTCGCCCGCCGGGTCACCCGCGGCGGCGTCGAGATCGTGCTGTCCGCGCGCGAGTTCGACATCTTGCAC
CTCCTGGTCTCGCACGCGGGGCGCGTGGTGAGCCGGCTGATGATCCTCGACGAGGTGTGGGACGGCGAGACCGACCTGCG
CAGCAACGTGATCGACGTGCACCTCGCCGCGATCCGGGCCAAGATCGACAAGCCGTTCGGTACCGAGACCATCACGACGC
TGCGCGGCGTCGGCTACCGCGTCGACCCGACCCCGGCGGTGCGATGA

Protein sequence : 
MRILVAEDDVRLADVLEESLAEAGWQVEVAHDGRSAYERLLSDSSLDVALLDWMLPGLDGVTVARRLRDLGVALPILMLT
ARGDVRDRVSGLDAGADDYLPKPFDLDELLARLRALYRRGSLVGEAPVQLGDLVVDPVARRVTRGGVEIVLSAREFDILH
LLVSHAGRVVSRLMILDEVWDGETDLRSNVIDVHLAAIRAKIDKPFGTETITTLRGVGYRVDPTPAVR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-24 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Noca_2062 YP_923258.1 two component transcriptional regulator BAC0083 Protein 3e-32 47
Noca_2062 YP_923258.1 two component transcriptional regulator BAC0638 Protein 4e-25 44
Noca_2062 YP_923258.1 two component transcriptional regulator BAC0347 Protein 6e-31 43
Noca_2062 YP_923258.1 two component transcriptional regulator BAC0125 Protein 1e-30 42
Noca_2062 YP_923258.1 two component transcriptional regulator BAC0111 Protein 7e-33 42
Noca_2062 YP_923258.1 two component transcriptional regulator BAC0487 Protein 2e-18 42
Noca_2062 YP_923258.1 two component transcriptional regulator BAC0308 Protein 1e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Noca_2062 YP_923258.1 two component transcriptional regulator VFG1390 Protein 3e-31 44
Noca_2062 YP_923258.1 two component transcriptional regulator VFG0596 Protein 5e-25 42
Noca_2062 YP_923258.1 two component transcriptional regulator VFG1389 Protein 1e-21 41