Gene Information

Name : Noca_4947 (Noca_4947)
Accession : YP_919389.1
Strain :
Genome accession: NC_008697
Putative virulence/resistance : Resistance
Product : regulatory protein, MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 282758 - 283147 bp
Length : 390 bp
Strand : +
Note : PFAM: regulatory protein, MerR; KEGG: cjk:jk1441 putative transcriptional regulator (MerR family)

DNA sequence :
ATGCGGATCGGAGAACTGGCCCACGCCGCCGGCACCACCACCAAGACGCTGCGGTTCTACGAGGACCAGGGCCTCCTGCC
AGCCGCGGAACGCACCCCGTCCGGCTACCGCGACTACACACCCGACGCGCTCGCACGGCTCGACTTCATCCACCGTGGCC
AGGCCGCCGGCCTGACCCTCGCCCAGATCCGGCAGATCCTCGGCATCCGTGACAGCGGCACCCCGCCATGCGGGCACGTG
CACGACCTCCTCGACGAACGCCTCACCGACCTGGACGCCCAGATCGCCCAGCTCGTCGCGCTCCGCGCCAGCCTCGCCGA
ACTCCGGGACCAGGCCGCACATGCCGATCCCGACGCCTGCCCCGCCGACCAGGTCTGCCGCTACCTGTGA

Protein sequence :
MRIGELAHAAGTTTKTLRFYEDQGLLPAAERTPSGYRDYTPDALARLDFIHRGQAAGLTLAQIRQILGIRDSGTPPCGHV
HDLLDERLTDLDAQIAQLVALRASLAELRDQAAHADPDACPADQVCRYL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-20 44
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 5e-20 44
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-20 44
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 3e-20 44
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 3e-20 44
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 5e-20 44
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 3e-20 44
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 3e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Noca_4947 YP_919389.1 regulatory protein, MerR BAC0058 Protein 9e-21 44