Gene Information

Name : Pden_3595 (Pden_3595)
Accession : YP_917358.1
Strain :
Genome accession: NC_008687
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 745050 - 745397 bp
Length : 348 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: pol:Bpro_5536 IS66 Orf2 like

DNA sequence :
GTGATCCCGGTTCCGGCGAACACACGGGTCTGGCTGGCGGCAGGCGTCACCGACATGCGCAAGGGCTTTGCGGCCTTGGC
GGCACAGGCCGAGGCCGTGCTGAAGCAGGACCCGTTTGCCGGGCATCTGTTCGTGTTCCGGGGCCGTCGTGGCGATCTGG
TGAAGGTCATCTGGTGGGACGAGCAAGGGGCTTGGATGTTCATGAAGCGGCTGGAGAAGGGGCGGTTCGTCTGGCCCTCG
GCCAAAGAGGGCAAGGTCGCGCTGACGCCTGCGCAGTTGTCGATGTTGCTGGAAGGGATCGACTGGCGGGCTCCTGAGCG
GACGTGGCGGCCTCTGGCAGCCGGGTAA

Protein sequence :
MIPVPANTRVWLAAGVTDMRKGFAALAAQAEAVLKQDPFAGHLFVFRGRRGDLVKVIWWDEQGAWMFMKRLEKGRFVWPS
AKEGKVALTPAQLSMLLEGIDWRAPERTWRPLAAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 2e-32 65
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-32 65
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-32 65
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 5e-28 63
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 9e-30 62
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 9e-30 62
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-29 59
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-29 59
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-28 58
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-28 58
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-28 58
unnamed AAC31493.1 L0014 Not tested LEE Protein 9e-29 58
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 9e-29 58
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-28 58
unnamed AAL99258.1 unknown Not tested LEE Protein 9e-29 58
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-28 58
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 9e-29 58
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-28 58
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-20 57
unnamed AAL08461.1 unknown Not tested SRL Protein 2e-28 57
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 9e-29 55
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 9e-29 55
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 3e-29 55
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 3e-29 55
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 5e-29 54

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pden_3595 YP_917358.1 IS66 Orf2 family protein VFG1665 Protein 8e-33 65
Pden_3595 YP_917358.1 IS66 Orf2 family protein VFG1698 Protein 1e-29 59
Pden_3595 YP_917358.1 IS66 Orf2 family protein VFG1709 Protein 4e-29 58
Pden_3595 YP_917358.1 IS66 Orf2 family protein VFG0792 Protein 4e-29 58
Pden_3595 YP_917358.1 IS66 Orf2 family protein VFG1517 Protein 4e-21 57
Pden_3595 YP_917358.1 IS66 Orf2 family protein VFG1052 Protein 7e-29 57
Pden_3595 YP_917358.1 IS66 Orf2 family protein VFG1737 Protein 1e-29 54