Gene Information

Name : Pden_0067 (Pden_0067)
Accession : YP_913880.1
Strain :
Genome accession: NC_008686
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 64712 - 65059 bp
Length : 348 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: sme:SMa1613 hypothetical protein

DNA sequence :
ATGATCGGGCCGGGAACCGGCGTTCGTGTCTATCTGGCCTGCGGCGTGACCGACATGAGGAAGGGAATCTCCGGGCTGGC
TGCACTTGCCCAGGATGTTCTGCGCCAGAAGCCGGCCGGCGGTGCGGTTTTTGCATTCCGCGGGCGTCGCGGCGACAGGT
TGAAATTGCTTCATTGGGATGGTCAGGGCTTCTGCCTGTATTACAAGGTGCTGGAGAAGGGGCGCTTTCCCTGGCCGATG
CGCGGGGATGGTGCGGTTCGCCTGACCTCGGCGCAGCTGGCCATGCTGTGGGAAGGCATTGACTGGCGCAGGCCGGATTG
GGGCGCGCCACCGGCCCGGGTGGGCTGA

Protein sequence :
MIGPGTGVRVYLACGVTDMRKGISGLAALAQDVLRQKPAGGAVFAFRGRRGDRLKLLHWDGQGFCLYYKVLEKGRFPWPM
RGDGAVRLTSAQLAMLWEGIDWRRPDWGAPPARVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-14 56
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-15 55
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-15 55
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-15 55
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 2e-15 55
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-15 55
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 2e-15 55
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-15 55
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 2e-15 55
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-15 55
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 8e-15 55
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-15 55
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 8e-15 55
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-15 53
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 4e-09 51
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 4e-17 51
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-17 51
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-14 51
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-14 51
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 8e-17 50
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-13 50
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 8e-13 50
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 8e-13 50
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-15 47
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-15 47

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pden_0067 YP_913880.1 IS66 Orf2 family protein VFG0792 Protein 6e-16 55
Pden_0067 YP_913880.1 IS66 Orf2 family protein VFG1698 Protein 5e-16 55
Pden_0067 YP_913880.1 IS66 Orf2 family protein VFG1709 Protein 6e-16 55
Pden_0067 YP_913880.1 IS66 Orf2 family protein VFG1052 Protein 1e-15 53
Pden_0067 YP_913880.1 IS66 Orf2 family protein VFG1517 Protein 2e-09 51
Pden_0067 YP_913880.1 IS66 Orf2 family protein VFG1665 Protein 3e-17 50
Pden_0067 YP_913880.1 IS66 Orf2 family protein VFG1737 Protein 3e-14 50