Gene Information

Name : Pden_1617 (Pden_1617)
Accession : YP_915412.1
Strain :
Genome accession: NC_008686
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1599137 - 1599460 bp
Length : 324 bp
Strand : -
Note : PFAM: transposase IS3/IS911 family protein; KEGG: nwi:Nwi_2119 transposase IS3/IS911

DNA sequence :
ATGAGCAAGACGACGAACAAGTTTTCCCCCGAAGTGCGTGAACGCGCGGTGCGGCTGGTCTTCGATAACGAGGGGCAGCA
TGGGTCGCGATGGCAGGCGATCGTGTTGATTGCCGCGAAGATCGGCTGTTCTGCCCATACCCTGAACGAGTGGGTGAAGA
AGGCCGAGGTCGACAGCGGCCAGCGGGCGGGGATCCCGACCGAGATGGCCGAGAAGATGAAGGCGCTGGAACGCGAGAAC
CGCGAGTTGCGCCAGGCCAACGAGGTTCTCCGCAAGGCGTCAGCATATTTTGCGATGGCGGAGCGCGACCGCCGGTCGAA
GTGA

Protein sequence :
MSKTTNKFSPEVRERAVRLVFDNEGQHGSRWQAIVLIAAKIGCSAHTLNEWVKKAEVDSGQRAGIPTEMAEKMKALEREN
RELRQANEVLRKASAYFAMAERDRRSK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-22 55
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-22 55
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-22 55
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-22 55
unnamed AAF09023.1 unknown Not tested SHI-O Protein 1e-19 54
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 1e-19 54
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 7e-19 54
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 1e-17 54
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 8e-18 54
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 2e-19 53
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-19 53
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 2e-19 53
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 3e-19 53
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 3e-19 53
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 3e-19 53
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 6e-22 53
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 6e-22 53
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 6e-22 53
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 5e-18 53
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 6e-22 53
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 9e-22 53
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 1e-18 53
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-20 52
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-20 52
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 3e-20 52
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-17 51
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 4e-17 51
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 3e-17 51
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 4e-17 51
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 3e-17 51
CDC7B_2036 YP_005163477.1 hypothetical protein Not tested Not named Protein 2e-11 41
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 9e-12 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Pden_1617 YP_915412.1 transposase IS3/IS911 family protein VFG1603 Protein 3e-19 54
Pden_1617 YP_915412.1 transposase IS3/IS911 family protein VFG0606 Protein 3e-19 53
Pden_1617 YP_915412.1 transposase IS3/IS911 family protein VFG0643 Protein 1e-19 53
Pden_1617 YP_915412.1 transposase IS3/IS911 family protein VFG1717 Protein 1e-17 51