Gene Information

Name : trcR (MUL_4624)
Accession : YP_908038.1
Strain : Mycobacterium ulcerans Agy99
Genome accession: NC_008611
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator TrcR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5123395 - 5124168 bp
Length : 774 bp
Strand : +
Note : cytoplasmic protein; sensor part of the two component regulatory system TrcS/TrcR. involved in transcriptional autoactivation: TrcR activates its own expression by interacting with the AT-rich sequence of the TrcR promoter.

DNA sequence : 
TTGAAAGCAATGACCGGATCCACGCGCACTCAACGTCCACGGCAGGCGATTTTGGGGCAGCTGCCCCGAATTCACCGTGC
CGACGGATCACCCATTCGGGTGCTCCTTGTCGACGACGAACCTGCGCTGACCAATCTGGTCAAAATGGCCCTGCACTACG
AAGGCTGGGACGTCGAGATCGCCCACAACGGGCGCGAGGCCATATCCAAGTTCGACAAGATCAGTCCTGACGTGTTGGTC
CTCGACATCATGCTGCCCGACGTCGACGGCCTGCAGATCCTGCAGCGGGTGCGCGACTCCGACGCATACACACCCACGCT
GTTCCTCACGGCACGCGATTCGGTGATGGACCGTGTCACCGGACTGACGGCCGGCGCCGACGACTACATGACCAAGCCGT
TCAGCCTCGAAGAGCTGGTGGCGCGGCTGCGCGGACTGTTGCGCCGCTCCAGTCATCTGGCGCCGCCCGCCGACGAGTCT
CTGAAGGTTGGTGACCTCAAGCTCGACGCAGCCAGCCGGGAAGTCACTCGCGGCGGCACCCCGATCTCGCTTTCCTCGAC
CGAGTTCGAGCTACTTCGATTCCTGATGCGCAACCCGCGCCGCGCGCTGAGCCGCACCGAGATCCTCGACCGGGTCTGGA
ACTACGACTTCGCCGGACGCACCAGCATCGTCGACCTCTACATCTCGTACTTGAGAAAGAAAATCGACGCGGACCGAGAG
CCGATGATTCACACGGTCCGCGGGATTGGATACATGCTACGACCAGCGGAATGA

Protein sequence : 
MKAMTGSTRTQRPRQAILGQLPRIHRADGSPIRVLLVDDEPALTNLVKMALHYEGWDVEIAHNGREAISKFDKISPDVLV
LDIMLPDVDGLQILQRVRDSDAYTPTLFLTARDSVMDRVTGLTAGADDYMTKPFSLEELVARLRGLLRRSSHLAPPADES
LKVGDLKLDAASREVTRGGTPISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDADRE
PMIHTVRGIGYMLRPAE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
trcR YP_908038.1 two component transcriptional regulator TrcR BAC0125 Protein 7e-33 44
trcR YP_908038.1 two component transcriptional regulator TrcR BAC0083 Protein 3e-32 43
trcR YP_908038.1 two component transcriptional regulator TrcR BAC0197 Protein 7e-31 43
trcR YP_908038.1 two component transcriptional regulator TrcR HE999704.1.gene1528. Protein 5e-34 42
trcR YP_908038.1 two component transcriptional regulator TrcR BAC0111 Protein 5e-29 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_002952.2859905.p0 Protein 7e-35 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_002951.3237708.p0 Protein 1e-34 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_003923.1003749.p0 Protein 9e-35 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_002758.1121668.p0 Protein 1e-34 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_009641.5332272.p0 Protein 1e-34 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_013450.8614421.p0 Protein 1e-34 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_007793.3914279.p0 Protein 1e-34 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_007622.3794472.p0 Protein 8e-35 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_002745.1124361.p0 Protein 1e-34 41
trcR YP_908038.1 two component transcriptional regulator TrcR NC_009782.5559369.p0 Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
trcR YP_908038.1 two component transcriptional regulator TrcR VFG1390 Protein 1e-46 49
trcR YP_908038.1 two component transcriptional regulator TrcR VFG1386 Protein 4e-45 47
trcR YP_908038.1 two component transcriptional regulator TrcR VFG1389 Protein 8e-34 44
trcR YP_908038.1 two component transcriptional regulator TrcR VFG0596 Protein 5e-27 41