Gene Information

Name : prrA (MUL_0248)
Accession : YP_904458.1
Strain : Mycobacterium ulcerans Agy99
Genome accession: NC_008611
Putative virulence/resistance : Virulence
Product : two component response transcriptional regulatory protein PrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 255802 - 256512 bp
Length : 711 bp
Strand : +
Note : Also detected in the membrane fraction by proteomics (2D-LC-MS/MS); membrane protein; transcriptional regulator part of the two component regulatory system PrrA/PrrB. thought to be involved in the environmental adaptation , specifically in an early phase

DNA sequence : 
ATGGGCGGCATGGACACTGGTGCGAACTCACCTCGGGTCTTGGTGGTCGACGACGATTCCGATGTGCTCGCCTCCCTGGA
GCGCGGTCTGCGGCTGTCCGGATTCGAAGTATCGACCGCCGTCGACGGTGCCGAGGCCTTGCGCAGCGCCACCGAGACCC
GGCCGGACGCGATCGTGCTCGACATCAACATGCCCGTGCTGGACGGCGTCAGTGTCGTTACCGCACTGCGTGCCATGGAC
AACGACGTCCCGGTCTGCGTGCTGTCCGCGCGCAGCTCGGTCGATGACCGAGTGGCCGGTCTGGAGGCCGGCGCAGATGA
CTATCTGGTCAAGCCATTCGTGCTGGCCGAATTGGTGGCCCGGGTCAAAGCGCTGCTGCGCCGCCGCGGGGCCACCGCGA
CATCTTCATCGGAAATCATCACGGTGGGCCCGCTGGAAGTAGACATCCCCGGCCGACGGGCCCGGGTCAACGGTGTCGAC
GTCGACCTCACCAAGCGCGAGTTCGACCTGCTCGCGGTCCTGGCCGAGCACAAGACGGCGGTGCTGTCGCGGGCACAACT
ACTCGAACTGGTGTGGGGCTATGACTTCGCCGCCGACACCAACGTCGTGGACGTATTCATCGGCTACCTACGCCGCAAGT
TGGAGGCCAACGGCGGCCCGCGGCTACTGCACACGGTCCGCGGGGTCGGATTCGTACTCAGGATGCATTGA

Protein sequence : 
MGGMDTGANSPRVLVVDDDSDVLASLERGLRLSGFEVSTAVDGAEALRSATETRPDAIVLDINMPVLDGVSVVTALRAMD
NDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRGATATSSSEIITVGPLEVDIPGRRARVNGVD
VDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEANGGPRLLHTVRGVGFVLRMH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-25 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA BAC0083 Protein 2e-30 46
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA BAC0125 Protein 8e-30 44
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA BAC0197 Protein 9e-25 44
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA AE000516.2.gene3505. Protein 3e-29 44
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA BAC0638 Protein 1e-23 43
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_012469.1.7685629. Protein 1e-26 43
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA HE999704.1.gene1528. Protein 3e-30 42
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_012469.1.7686381. Protein 3e-22 42
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_002758.1121390.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_010079.5776364.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_002952.2859858.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_007622.3794948.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_003923.1003417.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_013450.8614146.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_002951.3238224.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA NC_007793.3914065.p0 Protein 2e-32 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA BAC0347 Protein 9e-24 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA BAC0111 Protein 1e-25 41
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA HE999704.1.gene2815. Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA VFG1389 Protein 8e-85 97
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA VFG1390 Protein 6e-41 50
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA VFG1386 Protein 1e-36 46
prrA YP_904458.1 two component response transcriptional regulatory protein PrrA VFG0596 Protein 1e-25 43