Gene Information

Name : MSMEG_5488 (MSMEG_5488)
Accession : YP_889726.1
Strain : Mycobacterium smegmatis MC2 155
Genome accession: NC_008596
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5569498 - 5570190 bp
Length : 693 bp
Strand : -
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
GTGGCTGTGCGCATACTTGTCGTTGACGACGATCGCGCTGTGCGCGAATCCCTGCGCCGGTCGCTTTCCTTCAATGGTTA
TTCGGTCGAACTCGCCCAGGACGGGGTCGAGGCTCTCGACGCGATCACCAACAACCGGCCGGACGCCCTGATCCTCGACG
TCATGATGCCCAGGCTCGACGGCCTCGAGGTCTGCAGGCAGCTTCGCAGCACGGGCGACGACCTGCCGATCCTGGTGCTC
ACCGCGCGCGACTCGGTGTCCGAGCGCGTCGCCGGCCTGGACGCGGGCGCCGATGACTACCTGCCCAAGCCGTTCGCACT
CGAGGAACTGCTGGCGCGGATGCGCGCCCTGCTGCGCCGCACGGTCTCCGACGACAGTGGCGACTCGCAGAAGATGACGT
TCTCCGATCTGACGCTCGACCCGGTGACCCGCGAGGTCACGCGCGGCGGACGGCAGATCAGCCTGACGCGCACCGAGTTC
TCGCTGCTGGAGATGCTCATCGCCAACCCGCGGCGTGTGCTGACCCGCAGCCGCATCCTGGAAGAGGTGTGGGGATTCGA
TTTCCCGACCTCGGGCAACGCCCTTGAGGTCTACATCGGATATCTGCGCCGCAAGACCGAGGCAGAAGGCGAGCCGCGGC
TGATCCACACCGTGCGTGGCGTCGGCTACGTGCTGCGGGAAACGCCTCCGTAG

Protein sequence :
MAVRILVVDDDRAVRESLRRSLSFNGYSVELAQDGVEALDAITNNRPDALILDVMMPRLDGLEVCRQLRSTGDDLPILVL
TARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTVSDDSGDSQKMTFSDLTLDPVTREVTRGGRQISLTRTEF
SLLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEAEGEPRLIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSMEG_5488 YP_889726.1 DNA-binding response regulator BAC0083 Protein 5e-34 47
MSMEG_5488 YP_889726.1 DNA-binding response regulator BAC0308 Protein 8e-35 45
MSMEG_5488 YP_889726.1 DNA-binding response regulator BAC0125 Protein 4e-34 44
MSMEG_5488 YP_889726.1 DNA-binding response regulator BAC0638 Protein 1e-28 44
MSMEG_5488 YP_889726.1 DNA-binding response regulator HE999704.1.gene1528. Protein 5e-37 43
MSMEG_5488 YP_889726.1 DNA-binding response regulator BAC0347 Protein 1e-29 43
MSMEG_5488 YP_889726.1 DNA-binding response regulator BAC0111 Protein 1e-34 43
MSMEG_5488 YP_889726.1 DNA-binding response regulator AE000516.2.gene3505. Protein 1e-35 42
MSMEG_5488 YP_889726.1 DNA-binding response regulator BAC0197 Protein 1e-29 42
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_012469.1.7686381. Protein 2e-33 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 2e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 1e-29 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 3e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 3e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 3e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 2e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 3e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 3e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 3e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 3e-35 41
MSMEG_5488 YP_889726.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSMEG_5488 YP_889726.1 DNA-binding response regulator VFG1390 Protein 4e-87 90
MSMEG_5488 YP_889726.1 DNA-binding response regulator VFG1389 Protein 8e-45 53
MSMEG_5488 YP_889726.1 DNA-binding response regulator VFG1386 Protein 3e-45 50
MSMEG_5488 YP_889726.1 DNA-binding response regulator VFG0596 Protein 1e-32 41