Gene Information

Name : MSMEG_1716 (MSMEG_1716)
Accession : YP_886092.1
Strain : Mycobacterium smegmatis MC2 155
Genome accession: NC_008596
Putative virulence/resistance : Unknown
Product : IS3 family protein element, transposase orfA
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1812681 - 1812956 bp
Length : 276 bp
Strand : +
Note : identified by similarity to GP:15619022; match to protein family HMM PF01527

DNA sequence :
GTGCGGATGGTCCGCACGCTGCGCGAAGAGCTGGGCACCGAGCAGGGCACGGTAGCGCGGGTGGCCCGTCAGCTCGGCTA
CGGCGTGGAGTCGGTGCGCTCCTGGGTACGCCAGGCAGACATCGACGACGGTCACGCCCCGGGTGTGACGACCGCGGAGT
CAGCGAAGGTCAAAGAGCTCGAGCAAGAGATCCGAGAACTGAAGCGGGCCAACGAGATTCTGAAACGAGCGGCGAGTTTC
TTCGGGGCGGAGCTCGACCGCCAACACAAGAAATAG

Protein sequence :
MRMVRTLREELGTEQGTVARVARQLGYGVESVRSWVRQADIDDGHAPGVTTAESAKVKELEQEIRELKRANEILKRAASF
FGAELDRQHKK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 5e-13 42
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 2e-12 42
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 8e-10 42
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 5e-13 42
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 7e-13 42
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 8e-10 42
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 5e-13 42
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 5e-13 42
unnamed AAF09023.1 unknown Not tested SHI-O Protein 6e-10 42
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 6e-10 42
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 2e-12 42
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 5e-10 42
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 2e-12 42
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-10 42
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 5e-10 42
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 2e-12 42
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 8e-10 42
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-08 41
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-11 41
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 5e-09 41
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 3e-11 41
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 1e-07 41
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 3e-11 41
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-08 41
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 7e-09 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MSMEG_1716 YP_886092.1 IS3 family protein element, transposase orfA VFG0643 Protein 2e-10 42
MSMEG_1716 YP_886092.1 IS3 family protein element, transposase orfA VFG1603 Protein 2e-09 41
MSMEG_1716 YP_886092.1 IS3 family protein element, transposase orfA VFG0606 Protein 2e-09 41