
|
Name : MAV_3949 (MAV_3949) Accession : YP_883109.1 Strain : Mycobacterium avium 104 Genome accession: NC_008595 Putative virulence/resistance : Resistance Product : transporter, small multidrug resistance (SMR) family protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2076 EC number : - Position : 4076964 - 4077308 bp Length : 345 bp Strand : + Note : identified by similarity to SP:Q57225; match to protein family HMM PF00893 DNA sequence : ATGCGTGCGCGAGGAGGCGTCTTGACCTATCTGTTCTTGATTTGCGCGATTTTGGCCGAGGTGGTCGCGACCAGCCTGCT CAAGAGCACCCAGGGTTTCACCCGGCTGTGGCCCACCGTGATCTGTCTGCTCGGCTACGCCGTGTCCTTCGCGCTGCTGG CTGTGTCGATTTCGCGCGGCATGCAGACCGACGTCGCCTACGCGTTGTGGTCGGCCATCGGCACGGCGCTGATCGTGCTG ATCGCCGTGCTGTTCCTTGGCTCGCCGATATCGGTGACCAAGGTCGTCGGTGTCGGGCTGATCATCGCCGGCGTGGTGAC GCTGAACCTGACCGGGGCGCACTGA Protein sequence : MRARGGVLTYLFLICAILAEVVATSLLKSTQGFTRLWPTVICLLGYAVSFALLAVSISRGMQTDVAYALWSAIGTALIVL IAVLFLGSPISVTKVVGVGLIIAGVVTLNLTGAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 2e-09 | 41 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 2e-09 | 41 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 2e-09 | 41 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 2e-09 | 41 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 2e-09 | 41 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-09 | 41 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-09 | 41 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-09 | 41 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 2e-09 | 41 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-09 | 41 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 2e-09 | 41 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 2e-09 | 41 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 2e-09 | 41 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 2e-09 | 41 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 2e-09 | 41 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 2e-09 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| MAV_3949 | YP_883109.1 | transporter, small multidrug resistance (SMR) family protein | AE000516.2.gene3301. | Protein | 1e-30 | 83 |
| MAV_3949 | YP_883109.1 | transporter, small multidrug resistance (SMR) family protein | BAC0249 | Protein | 1e-30 | 83 |
| MAV_3949 | YP_883109.1 | transporter, small multidrug resistance (SMR) family protein | BAC0150 | Protein | 2e-11 | 44 |
| MAV_3949 | YP_883109.1 | transporter, small multidrug resistance (SMR) family protein | NC_002695.1.913273.p | Protein | 2e-11 | 44 |
| MAV_3949 | YP_883109.1 | transporter, small multidrug resistance (SMR) family protein | CP001138.1.gene1489. | Protein | 2e-09 | 41 |
| MAV_3949 | YP_883109.1 | transporter, small multidrug resistance (SMR) family protein | BAC0323 | Protein | 7e-10 | 41 |