Gene Information

Name : NT01CX_0667 (NT01CX_0667)
Accession : YP_879133.1
Strain : Clostridium novyi NT
Genome accession: NC_008593
Putative virulence/resistance : Resistance
Product : tellurium resistance protein terD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2356957 - 2357538 bp
Length : 582 bp
Strand : -
Note : identified by match to protein family HMM PF02342

DNA sequence :
ATGGCAGTTAGTTTATCAAAGGGACAAAAGGTGGATTTAACAAAGACAAATCCAGGATTAAAAAAGGTAATAGTAGGACT
TGGATGGGATACTAACAAGTATGATGGAGGAAATGACTTTGATTTAGATGCAGCATCATTTTTATTGGGATTAAATGGAA
AAGTTGCATCTGATGGAGATTTTGTTTTTTACAATAATTTAAAGCATTCTTCAGAATCTGTAATTCATCTAGGAGATAAC
CGTACTGGTGAAGGGGATGGAGATGATGAACAAATAGTTGTTGAATTAAATAAGGTACCTTCTAATATAGAAAAAATAGA
TTTTACAGTAACTATACATGATGCAGAAACAAGACAACAAAATTTTGGACAAGTATCCAATGCATTTATAAGAATAGTAA
ACGAAGAAACTAATGAAGAATTAATAAGATATGATTTAAGTGAAGACTACAGTATAGAAACGGCTTTAGTGGTTGGTGAA
TTATATCGTCATAATGGAGAATGGAAATTCAGTGCTATAGGAAGTGGATTTGAAGGGGGACTTGGAGCGCTTTGTGGCAA
TTTTGGAATAGATGTAGGATAG

Protein sequence :
MAVSLSKGQKVDLTKTNPGLKKVIVGLGWDTNKYDGGNDFDLDAASFLLGLNGKVASDGDFVFYNNLKHSSESVIHLGDN
RTGEGDGDDEQIVVELNKVPSNIEKIDFTVTIHDAETRQQNFGQVSNAFIRIVNEETNEELIRYDLSEDYSIETALVVGE
LYRHNGEWKFSAIGSGFEGGLGALCGNFGIDVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 8e-58 61
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 61
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-58 61
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-56 60
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-49 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-48 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-48 56
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-49 56
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-25 41
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-27 41
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
NT01CX_0667 YP_879133.1 tellurium resistance protein terD BAC0389 Protein 2e-58 61
NT01CX_0667 YP_879133.1 tellurium resistance protein terD BAC0390 Protein 5e-53 58