Gene Information

Name : Acel_1595 (Acel_1595)
Accession : YP_873353.1
Strain : Acidothermus cellulolyticus 11B
Genome accession: NC_008578
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1794877 - 1795560 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: nfa:nfa49640 putative two-component system response regulator

DNA sequence :
GTGCGCGTCCTCGTGGTCGATGACGACCCCGCCGTCCGGGAGTCGCTGCGCCGCTCCCTGGTGTTCAACGGCTACGACGT
TGAGTTGGCGGACGACGGGCAGCGTGCCCTCGCGATGATCAATATGCGCCGGCCCGACGTCGTCATCCTTGACGTTCTGA
TGCCCGGCCTCGACGGCCTGGAGACCTGTCGCCGCTTGCGGGCCGCCGGTGACGACGTTCCCGTGCTCATGCTCACCGCG
CGGGAAGCGGTGAGCGACCGGGTCGCCGGGCTGGACGCCGGCGCCGATGACTACCTTGTCAAGCCGTTCGCGCTGGAGGA
ATTGCTCGCCCGGTTGCGCGCGCTCGTGCGGCGCAGTGCGCCGGGTCCCGGGGCGAGTCAGCAGCTGCGGTTCTCGGACC
TGACACTGGATCTCGCGACCCGCGAGGTGTGGCGGGGCAGCCGGCCGATCGCGCTGACCCGCACCGAATTCAACCTGCTC
GAAATGTTCATGCGCCATCCGCGTCAGGTATTGCGGCGCTCGCAGATTCTTGAGGAAGTCTGGGGATACGATTTTCCGAC
GACAGCGAATTCACTGGAAGTGTACGTCGGCTATTTGCGCCGCAAACTCGAGGCACAGGGCGAACCGCGGCTCATCCATA
CGATCCGCGGCGTGGGATACGCGTTGCGCGAGATGTCACCGTGA

Protein sequence :
MRVLVVDDDPAVRESLRRSLVFNGYDVELADDGQRALAMINMRRPDVVILDVLMPGLDGLETCRRLRAAGDDVPVLMLTA
REAVSDRVAGLDAGADDYLVKPFALEELLARLRALVRRSAPGPGASQQLRFSDLTLDLATREVWRGSRPIALTRTEFNLL
EMFMRHPRQVLRRSQILEEVWGYDFPTTANSLEVYVGYLRRKLEAQGEPRLIHTIRGVGYALREMSP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acel_1595 YP_873353.1 two component transcriptional regulator BAC0638 Protein 5e-29 46
Acel_1595 YP_873353.1 two component transcriptional regulator BAC0125 Protein 1e-36 45
Acel_1595 YP_873353.1 two component transcriptional regulator BAC0347 Protein 3e-32 44
Acel_1595 YP_873353.1 two component transcriptional regulator BAC0111 Protein 1e-35 44
Acel_1595 YP_873353.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-36 44
Acel_1595 YP_873353.1 two component transcriptional regulator BAC0083 Protein 5e-34 43
Acel_1595 YP_873353.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-24 42
Acel_1595 YP_873353.1 two component transcriptional regulator BAC0197 Protein 3e-31 42
Acel_1595 YP_873353.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-35 41
Acel_1595 YP_873353.1 two component transcriptional regulator BAC0308 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acel_1595 YP_873353.1 two component transcriptional regulator VFG1390 Protein 2e-69 73
Acel_1595 YP_873353.1 two component transcriptional regulator VFG1386 Protein 3e-47 51
Acel_1595 YP_873353.1 two component transcriptional regulator VFG1389 Protein 2e-42 50
Acel_1595 YP_873353.1 two component transcriptional regulator VFG0596 Protein 4e-31 41