Gene Information

Name : Shewana3_3440 (Shewana3_3440)
Accession : YP_871069.1
Strain : Shewanella sp. ANA-3
Genome accession: NC_008577
Putative virulence/resistance : Resistance
Product : penicillin-binding protein, transpeptidase
Function : -
COG functional category : V : Defense mechanisms
COG ID : COG2602
EC number : -
Position : 4122443 - 4123240 bp
Length : 798 bp
Strand : -
Note : PFAM: penicillin-binding protein, transpeptidase; KEGG: son:SO0837 beta-lactamase, putative

DNA sequence : 
ATGCGTGCGTTAGCCTTATCGGCTGTGTTGCTGGTGACAACGATGATTGGCATGCCTGCGGTGGCAAAGGAGTGGCAAGA
GAACAAGAGCTGGAATGCTCACTTTAGCGAACATAAAACCCAAGGCGTGGTTGTGCTGTGGAACGAGAATACACAGCAGG
GTTTTACTAACGATCTTAAACGGGCAAACCAAGCATTTTTACCTGCATCGACCTTTAAGATCCCAAACAGTTTAATTGCC
TTGGACTTAGGTGTGGTTAAGGATGAGCATCAAGTCTTTAAATGGGATGGACAGACGCGAGATATCGCCGCATGGAATCG
CGACCATGATTTAATCACCGCGATGAAGTATTCGGTTGTGCCTGTTTATCAAGAATTTGCCCGCCAAATTGGCGAGGCTC
GTATGAGTAAAATGCTGCACGCCTTCGATTATGGCAATGAGGATATCTCGGGCAATTTAGACAGCTTTTGGCTCGATGGT
GGTATTCGAATTTCGGCTACCCAGCAAATCGCTTTTTTACGCAAGCTGTACCACAACAAGCTGCACGTTTCTGAGCGTAG
TCAGCGCATCGTCAAGCAAGCCATGCTGACCGAGGCAAATGCCGATTATATTATCCGAGCGAAAACTGGTTACTCGACGC
GAATTGAGCCGAAAATTGGTTGGTGGGTTGGCTGGGTCGAACTCGATGACAATGTGTGGTTCTTCGCGACCAATATGGAT
ATGCCTTCCGCTGAGGGCCTAGGGTTACGTCAAAGCATTACGAAAACAGTGCTGAAACAGGAAAAAATTATTCCTTAG

Protein sequence : 
MRALALSAVLLVTTMIGMPAVAKEWQENKSWNAHFSEHKTQGVVVLWNENTQQGFTNDLKRANQAFLPASTFKIPNSLIA
LDLGVVKDEHQVFKWDGQTRDIAAWNRDHDLITAMKYSVVPVYQEFARQIGEARMSKMLHAFDYGNEDISGNLDSFWLDG
GIRISATQQIAFLRKLYHNKLHVSERSQRIVKQAMLTEANADYIIRAKTGYSTRIEPKIGWWVGWVELDDNVWFFATNMD
MPSAEGLGLRQSITKTVLKQEKIIP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
bla OXA-10 CAJ77047.1 Oxacillinase Not tested AbaR1 Protein 1e-59 51
blaOXA-129 AET25386.1 OXA-129 beta-lactamase Not tested PAGI-2(C) Protein 2e-55 49
bla OXA-129 AFG30109.1 OXA-129 beta-lactamase Not tested PAGI-2 Protein 2e-55 49
ACICU_00226 YP_001844885.1 Beta-lactamase class D Not tested AbaR20 Protein 2e-40 43
blaOXA-2 YP_005176242.1 beta-lactamase OXA-2 protein Not tested ICEPmu1 Protein 1e-39 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase JN205800.1.gene6.p01 Protein 7e-113 95
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase HM015773.1.gene6.p01 Protein 2e-112 93
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AY500137.1.gene1.p01 Protein 2e-111 91
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase HQ700343.1.gene1.p01 Protein 2e-108 91
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AY343493.1.gene1.p01 Protein 6e-72 58
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase U37105.2.gene2.p01 Protein 6e-60 51
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase NC_010410.6002874.p0 Protein 6e-60 51
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase Z22590.1.gene1.p01 Protein 2e-59 50
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AJ854182.1.gene1.p01 Protein 1e-59 50
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AM932669.1.gene2.p01 Protein 1e-55 49
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase X58272.1.gene1.p01 Protein 9e-56 49
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase X75562.1.gene1.p01 Protein 2e-56 48
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase U59183.1.gene3.p01 Protein 2e-59 48
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AY445080.1.gene1.p01 Protein 1e-58 48
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AF231133.1.gene3.p01 Protein 4e-58 48
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AM412777.1.gene1.p01 Protein 9e-59 48
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AF317511.1.gene5.p01 Protein 2e-39 44
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase Y10693.2.gene1.p2 Protein 4e-40 44
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase L07945.1.gene1.p01 Protein 2e-40 44
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase DQ522237.1.gene5.p01 Protein 4e-40 44
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AF300985.1.gene1.p01 Protein 2e-38 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AY139598.1.gene3.p01 Protein 2e-40 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AF371964.1.gene1.p1 Protein 1e-39 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AF024602.1.gene3.p01 Protein 7e-41 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AF350424.1.gene1.p01 Protein 4e-37 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase JF800667.1.gene2.p01 Protein 5e-39 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase M95287.gene.p01 Protein 5e-40 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase JF795487.1.gene1.p01 Protein 4e-39 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AF315351.1.gene2.p01 Protein 3e-40 43
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase U63835.1.gene1.p01 Protein 1e-39 42
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase GQ202693.1.gene2.p01 Protein 6e-40 42
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase EF552405.1.gene1.p01 Protein 1e-39 42
Shewana3_3440 YP_871069.1 penicillin-binding protein, transpeptidase AY289608.1.gene2.p01 Protein 2e-39 42