Gene Information

Name : Shewana3_4313 (Shewana3_4313)
Accession : YP_863828.1
Strain :
Genome accession: NC_008573
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 202785 - 203060 bp
Length : 276 bp
Strand : -
Note : TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: ilo:IL1645 periplasmic mercuric ion binding protein, MerP

DNA sequence :
ATGAAGAAAATTGCCTTGTTGTCTTTGCTAGCCTTGACCAGCCTGACCGCTTTTGCTGCGCCGAAAACAGTTACTTTGGA
AGTTCCAACCATGAACTGTGTGACCTGCCCCTTTACGGTCAAAAATGCCTTAAAAAATGTTGAGGGTGTGAGTAAAGCTG
AAGTCACCTTTGAAACCAAATTGGCAGTTGTCACATTCGACGACGAAAAAACCACAGTAAAAGCACTGACCGAAGCCACC
ACTAATGCGGGTTATCCATCAACGCTCAAGGAGTAA

Protein sequence :
MKKIALLSLLALTSLTAFAAPKTVTLEVPTMNCVTCPFTVKNALKNVEGVSKAEVTFETKLAVVTFDDEKTTVKALTEAT
TNAGYPSTLKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 2e-17 65
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 6e-18 64
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 8e-18 64
merP AFG30122.1 MerP Not tested PAGI-2 Protein 8e-17 62
merP AGK07023.1 MerP Not tested SGI1 Protein 8e-17 62
merP AGK07081.1 MerP Not tested SGI1 Protein 8e-17 62
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-16 62
merP ABQ57373.1 MerP Not tested SGI1 Protein 8e-17 62
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 8e-17 62
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-17 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shewana3_4313 YP_863828.1 mercuric transport protein periplasmic component BAC0675 Protein 1e-18 69
Shewana3_4313 YP_863828.1 mercuric transport protein periplasmic component BAC0679 Protein 2e-17 66
Shewana3_4313 YP_863828.1 mercuric transport protein periplasmic component BAC0231 Protein 9e-17 66
Shewana3_4313 YP_863828.1 mercuric transport protein periplasmic component BAC0678 Protein 8e-18 65
Shewana3_4313 YP_863828.1 mercuric transport protein periplasmic component BAC0674 Protein 9e-16 55