
|
Name : rpmE2 (GFO_1063) Accession : YP_861104.2 Strain : Gramella forsetii KT0803 Genome accession: NC_008571 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L31 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0254 EC number : - Position : 1136907 - 1137161 bp Length : 255 bp Strand : + Note : RpmE2; there appears to be two types of ribosomal proteins L31 in bacterial genomes; some contain a CxxC motif while others do not; Bacillus subtilis has both types; the proteins in this cluster do not have the CXXC motif; RpmE is found in exponentially g DNA sequence : ATGAAGCAGGGAATCCATCCGGAAAATTATAGATTAGTAGCATTTAAAGATATGTCTAATGAAGACGTATTTCTTACAAA GTCTACTGCAAAAACAAAAGAAAGCATTGAAGTTGACGGAACTGAATACCCGTTGGTAAAACTGGAGATATCCAGAACTT CTCACCCATACTACACAGGGCAAACTAAGCTTGTGGATAGTGCTGGTAGAATTGATAAATTCAAGAACAAATACTCGAAA TTCAAGAAAAAGTAA Protein sequence : MKQGIHPENYRLVAFKDMSNEDVFLTKSTAKTKESIEVDGTEYPLVKLEISRTSHPYYTGQTKLVDSAGRIDKFKNKYSK FKKK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmE2 | NP_287095.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-10 | 48 |
| rpmE2 | NP_286687.1 | 50S ribosomal protein L31 | Not tested | TAI | Protein | 1e-10 | 48 |