Gene Information

Name : APECO1_1051 (APECO1_1051)
Accession : YP_853069.1
Strain : Escherichia coli APEC O1
Genome accession: NC_008563
Putative virulence/resistance : Unknown
Product : phage integrase
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG0582
EC number : -
Position : 2091013 - 2091975 bp
Length : 963 bp
Strand : +
Note : -

DNA sequence :
ATGCTGGCGCTGAATATCAACCCGGTACAGCAGCGGGCTGCTGTACGTGGCTCACGAACACCGGAGAAAGTTTTTAAAAA
CGTGGCGCTGGCGTGGCATAAAAGTAACAGGAAATGGTCGCAGAACACCGCCGACCGTCTGCTTGCCAGCCTGAACAATC
ACATCTTTCCGGTCATCGGGAACCTACCTGTATCAGAACTTAAACCCCGTCATTTCATTGACCTGCAGAAAGGGATCGAG
GAAAAAGGTCTGCTGGAGGTTGCGTCCCGCACACGGCAGCACCTGAGTAACATAATACGCCATGCGGTCCATCAGGAGTT
AATCGATACGAACCCTGCAGCAAACCTTGGCGGCGTGACCACACCTCCTGTCAGACGGCACTATCCTGCCCTGCCGCTGG
AGCGGCTGCCTGAACTGCTTGAACGTATTGGGGCATATCATCAGGGCCGTGAACTGACCCGGCATGCCGTTCTGCTGATG
CTGCATGTGTTCATTCGCTCCAGTGAACTGCGTTTCGCCCGCTGGTCAGAGATTGATTTCACAAACCGAGTCTGGACGAT
ACCCGCGACGCGAGAACCCATTATTGGCGTGCATTATTCCGGCCGCGGGGCAAAAATGCGAATGCCGCATATCGTCCCCC
TCTCAGAACAGTCCATCGCCATTCTGAAACAGATTAAGGATATCACCGGTAATAATGAACTGATCTTCCCCGGCGACCAT
AACCCGTATAAGCCAATGTGTGAAAACACGGTCAATAAGGCACTGCGGGTGATGGGTTACGACACGAAAAAGGATATCTG
CGGTCACGGCTTCCGGGCAATGGCATGCAGTGCGCTGATGGAATCGGGTTTATGGGCAAAGGACGCAGTAGAACGCCAGA
TGAGTCATCAGGAGCGCAATACCGTGCGCATGGCTTATATTCATAAGGCAGAGCACCTGGAAGCCCGCAAAGCGATGATG
TAG

Protein sequence :
MLALNINPVQQRAAVRGSRTPEKVFKNVALAWHKSNRKWSQNTADRLLASLNNHIFPVIGNLPVSELKPRHFIDLQKGIE
EKGLLEVASRTRQHLSNIIRHAVHQELIDTNPAANLGGVTTPPVRRHYPALPLERLPELLERIGAYHQGRELTRHAVLLM
LHVFIRSSELRFARWSEIDFTNRVWTIPATREPIIGVHYSGRGAKMRMPHIVPLSEQSIAILKQIKDITGNNELIFPGDH
NPYKPMCENTVNKALRVMGYDTKKDICGHGFRAMACSALMESGLWAKDAVERQMSHQERNTVRMAYIHKAEHLEARKAMM

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
APECO1_1051 YP_853069.1 phage integrase Not tested PAI IV APEC-O1 Protein 5e-146 100
int ACR23151.1 P4-like integrase Not tested HPI Protein 3e-104 100
int ACR23152.1 P4-like integrase Not tested HPI Protein 3e-104 100
int ACR23162.1 P4-like integrase Not tested HPI Protein 3e-104 100
int ACR23163.1 P4-like integrase Not tested HPI Protein 3e-104 100
int ACR23166.1 P4-like integrase Not tested HPI Protein 3e-104 100
intB AAD37509.1 P4-like integrase Not tested PAI IV 536 Protein 4e-141 99
int ACR23165.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23149.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23135.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23122.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23142.1 P4-like integrase Not tested HPI Protein 7e-103 99
intB ADN38966.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38958.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38948.1 P4-like integrase Not tested HPI Protein 1e-102 99
int ACR23167.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23153.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23137.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23123.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23145.1 P4-like integrase Not tested HPI Protein 7e-103 99
intB ADN38967.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38959.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38951.1 P4-like integrase Not tested HPI Protein 1e-102 99
int ACR23154.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23138.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23124.1 P4-like integrase Not tested HPI Protein 3e-103 99
intB ADN38949.1 P4-like integrase Not tested HPI Protein 4e-103 99
intB ADN38968.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38960.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38952.1 P4-like integrase Not tested HPI Protein 1e-102 99
int ACR23155.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23143.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23129.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23133.1 P4-like integrase Not tested HPI Protein 4e-103 99
intB ADN38969.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38961.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38953.1 P4-like integrase Not tested HPI Protein 1e-102 99
int ACR23156.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23144.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23130.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23140.1 P4-like integrase Not tested HPI Protein 4e-103 99
intB ADN38950.1 P4-like integrase Not tested HPI Protein 9e-103 99
intB ADN38962.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38954.1 P4-like integrase Not tested HPI Protein 1e-102 99
int ACR23157.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23146.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23131.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23158.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23136.1 P4-like integrase Not tested HPI Protein 7e-103 99
intB ADN38963.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38955.1 P4-like integrase Not tested HPI Protein 1e-102 99
int ACR23125.1 P4-like integrase Not tested HPI Protein 3e-102 99
int ACR23161.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23147.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23132.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23159.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23139.1 P4-like integrase Not tested HPI Protein 7e-103 99
intB ADN38964.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38956.1 P4-like integrase Not tested HPI Protein 1e-102 99
int ACR23128.1 P4-like integrase Not tested HPI Protein 3e-102 99
int ACR23164.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23148.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23134.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23150.1 P4-like integrase Not tested HPI Protein 3e-103 99
int ACR23141.1 P4-like integrase Not tested HPI Protein 7e-103 99
intB ADN38965.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38957.1 P4-like integrase Not tested HPI Protein 1e-102 99
intB ADN38947.1 P4-like integrase Not tested HPI Protein 1e-102 99
int CAB59975.1 integrase Not tested HPI Protein 9e-104 99
int2 NP_993013.1 integrase Not tested HPI Protein 6e-142 99
int CAA21384.1 - Not tested HPI Protein 6e-142 99
int CAA08754.1 integrase Not tested HPI Protein 2e-142 99
int YP_002346908.1 integrase Not tested HPI Protein 6e-142 99
y2393 NP_669700.1 prophage integrase Not tested HPI Protein 6e-142 99
int ACR23127.1 P4-like integrase Not tested HPI Protein 2e-101 98
int ACR23160.1 P4-like integrase Not tested HPI Protein 2e-101 98
int ACR23126.1 P4-like integrase Not tested HPI Protein 2e-101 98
int CAB59974.1 integrase Not tested HPI Protein 7e-141 98
unnamed AAD17660.1 unknown Not tested HPI Protein 3e-138 96
SESS1296_03598 AFO66301.1 bacteriophage integrase Not tested SESS LEE Protein 2e-84 58
SESS1635_03816 AFO66367.1 bacteriophage integrase Not tested SESS LEE Protein 2e-84 58
int NP_458759.1 bacteriophage integrase Not tested SPI-7 Protein 6e-84 56
int NP_807963.1 bacteriophage integrase Not tested SPI-7 Protein 6e-84 56
int AAK00456.1 Int Not tested SHI-1 Protein 2e-77 55
intB CAD42017.1 bacteriophage P4 integrase Not tested PAI II 536 Protein 3e-83 55
int CAC81896.1 integrase Not tested LEE II Protein 3e-77 55
ECO111_3718 YP_003236059.1 putative integrase Not tested LEE Protein 8e-78 55
S4822 NP_838459.1 P4-type integrase Not tested SHI-1 Protein 2e-77 55
SF2964 NP_708738.1 P4-type integrase Not tested SHI-1 Protein 2e-77 55
APECO1_3534 YP_854214.1 P4-like integrase Not tested PAI I APEC-O1 Protein 4e-77 55
c5216 NP_757064.1 prophage P4 integrase Not tested PAI II CFT073 Protein 2e-77 55
ORF_1 AAZ04412.1 phage integrase Not tested PAI I APEC-O1 Protein 3e-77 55
int AAL51003.1 CP4-like integrase Not tested LEE Protein 2e-77 55
c3556 NP_755431.1 prophage P4 integrase Not tested PAI I CFT073 Protein 2e-77 55
int-phe AAL57571.1 CP4-like integrase Not tested LEE Protein 2e-77 55
ECUMN_3322 YP_002414004.1 integrase Not tested Not named Protein 2e-76 55
int AAL51028.1 CP4-like integrase Not tested LEE Protein 2e-77 55
int-phe AAL60261.1 Int-phe Not tested LEE Protein 2e-77 55
int AAT48697.1 CP4-like integrase Not tested PAI I 4787 Protein 3e-77 55
intP4 CAE85151.1 CP4 integrase protein Not tested PAI V 536 Protein 1e-77 55
ECO103_3550 YP_003223418.1 integrase Not tested LEE Protein 2e-77 55
int AAK16198.1 Int Not tested PAI-I AL862 Protein 6e-78 55
ECO26_5300 YP_003232178.1 integrase Not tested LEE Protein 2e-77 55
int ADD91747.1 P4 integrase Not tested PAI-I AL862 Protein 6e-78 55
Z4313 NP_289539.1 pathogenicity island integrase Not tested OI-122 Protein 2e-77 55
unnamed ABR13507.1 phage integrase Not tested PAGI-6 Protein 4e-71 51
STY4821 NP_458899.1 integrase Not tested SPI-10 Protein 3e-75 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
APECO1_1051 YP_853069.1 phage integrase VFG1536 Protein 2e-83 55
APECO1_1051 YP_853069.1 phage integrase VFG0626 Protein 9e-78 55
APECO1_1051 YP_853069.1 phage integrase VFG1693 Protein 9e-78 55