Gene Information

Name : Sfum_0707 (Sfum_0707)
Accession : YP_844840.1
Strain : Syntrophobacter fumaroxidans MPOB
Genome accession: NC_008554
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 861154 - 861837 bp
Length : 684 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: dde:Dde_2387 two component transcriptional regulator, winged helix family

DNA sequence :
ATGTCCGGATCGAGTGTGCTCATTGTCGAGGACGACGATGATATTCTTCATCTCCTGGCGTACAATGTCCGCGCGGCGGG
GTTTGCAGTCTTCACCGCGCAGGAGGGGTACGAAGCGCTCAGGATTGCGAAGGAACGCCGGCCCGGGCTGATCGTCCTGG
ACCTGATGATCCCGGGGGCGGATGGGTTCGAAGTTTGCCGGGAGCTGAAAAGAGGCTCGGACACCAGGGGCATCCCGGTC
ATCATGTTGACGGCCCGGGGTGAGGAAGTGGATCGCATCGTGGGGTTGGAGCTTGGAGCCGATGATTATGTCGTCAAACC
TTTCAGCCCCCGGGAACTGATTCTCCGGATTCGCGCCGTGCTGCGAAGATCCCCGCCGGACGGCGCGCAGGGGTCCGTCT
GGCAGCTTGAAGGTTTAAGAATTGATTTCGATGCGCACAAGGTCTTGATCGACGGCGAAGATGTCCTTTTCACGGCAACG
GAATTCAAACTCCTGGTGGAGCTGATCCGCAGCCGCGGGAAGGTGAAGTCGCGCGATTACTTGCTCGACAAGGTCTGGGG
TTATCATTTTGAAGGTTACGCCAGAACGGTCGACACGCACGTGAGGCGGTTGCGGCAGAAGCTGGGGCCCTACGCCGATC
GGGTCGAAACCGTACGCGGCATCGGGTATCGTTTCCGGGACTGA

Protein sequence :
MSGSSVLIVEDDDDILHLLAYNVRAAGFAVFTAQEGYEALRIAKERRPGLIVLDLMIPGADGFEVCRELKRGSDTRGIPV
IMLTARGEEVDRIVGLELGADDYVVKPFSPRELILRIRAVLRRSPPDGAQGSVWQLEGLRIDFDAHKVLIDGEDVLFTAT
EFKLLVELIRSRGKVKSRDYLLDKVWGYHFEGYARTVDTHVRRLRQKLGPYADRVETVRGIGYRFRD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 9e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfum_0707 YP_844840.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-39 44
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_008702.1.4607594. Protein 1e-32 43
Sfum_0707 YP_844840.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-40 42
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-36 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 6e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 6e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 6e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 6e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 6e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 6e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-41 41
Sfum_0707 YP_844840.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 6e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sfum_0707 YP_844840.1 two component transcriptional regulator VFG1702 Protein 3e-32 41