Gene Information

Name : Bcen2424_6858 (Bcen2424_6858)
Accession : YP_840480.1
Strain :
Genome accession: NC_008545
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 72602 - 72949 bp
Length : 348 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: bte:BTH_I3141 TnpB protein

DNA sequence :
GTGATCGGCTTGCCGAGTCGAACTCGCGTCTGGTTGGCTGCAGGCGTGACCGACATGCGCTGCGGGTTCAACACCCTGGC
GGCCAAGGTCCAGACCGTGCTGGAGCGAGACCCGTTCAGCGGGCACGTGTTCGTGTTTCGTGGCCGGCGGGGCGATCTGG
TCAAAGTGCTGTGGTGGAGCGGCGACGGCATGTGTCTGCTGATGAAACGCCTGGAGCGTGGGCGCTTCATCTGGCCGCGC
GCCGATGGCGGCGTGGTCTGCCTGAGCCAGGCCCAGTTATCGATGCTGCTCGAAGGCATCGACTGGCGGCAGCCGGTGCG
TACGACCGAGCCGAGTTCGGCGTTGTAA

Protein sequence :
MIGLPSRTRVWLAAGVTDMRCGFNTLAAKVQTVLERDPFSGHVFVFRGRRGDLVKVLWWSGDGMCLLMKRLERGRFIWPR
ADGGVVCLSQAQLSMLLEGIDWRQPVRTTEPSSAL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-39 77
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 8e-33 72
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 8e-33 72
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-33 72
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-33 72
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-33 72
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-33 72
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-33 72
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-33 72
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-33 72
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 2e-32 72
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-33 72
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 2e-32 72
unnamed AAL08461.1 unknown Not tested SRL Protein 5e-33 71
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-24 69
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-34 65
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 6e-34 65
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-34 65
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-33 64
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-33 64
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-29 61
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-29 61
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 8e-31 61
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 8e-31 61
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-30 60

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_6858 YP_840480.1 IS66 Orf2 family protein VFG1709 Protein 1e-33 72
Bcen2424_6858 YP_840480.1 IS66 Orf2 family protein VFG1698 Protein 2e-33 72
Bcen2424_6858 YP_840480.1 IS66 Orf2 family protein VFG0792 Protein 1e-33 72
Bcen2424_6858 YP_840480.1 IS66 Orf2 family protein VFG1052 Protein 2e-33 71
Bcen2424_6858 YP_840480.1 IS66 Orf2 family protein VFG1517 Protein 7e-25 69
Bcen2424_6858 YP_840480.1 IS66 Orf2 family protein VFG1665 Protein 2e-34 65
Bcen2424_6858 YP_840480.1 IS66 Orf2 family protein VFG1737 Protein 3e-31 60