Gene Information

Name : Bcen2424_6324 (Bcen2424_6324)
Accession : YP_839949.1
Strain :
Genome accession: NC_008544
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 511495 - 512172 bp
Length : 678 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bcn:Bcen_1505 two component heavy metal response transcriptional regulator, winged helix family

DNA sequence :
ATGCGCATCCTGATAGTCGAAGACGAACCGAAGACGGGCGCGTACCTGAAGAAGGGGCTCGAGGAATCGGGTTTCAGCGT
CGATCTCGCGAAGGACGGCGGCGAAGGGCTGACGCTCGCGCAGGAAGAGCGTTACGACGTGATCGTGCTCGACGTGATGC
TGCCCGTGCTCGACGGCTGGGCCGTGCTCAAGCGGCTGCGCGACACGCACACGACGCCGGTGCTGTTCCTGACCGCGCGC
GACGACGTGCAGGACCGCGTGCACGGCCTCGAACTCGGCGCCGACGACTACCTCGTGAAGCCGTTCGCGTTCGTCGAGCT
GCTCGCTCGCATCCGCACGCTCGCGCGTCGCGGGCCGCCGCGCGAGACCGAACATCTGGCGGTCGGCGATCTGGAAATCG
ACGTGGTGCGCCGCCGCGTGAAGCGCGGCGCCACGCGGATCGACCTGACGCCGCGCGAATTCTCGCTGCTGCAACTGCTC
GCGCGCCGGCAGGGCGAGGTGCTGAGCCGCACGCAGATCGCGTCGTACGTATGGGACATGAATTTCGACAGCGACACCAA
CGTCGTCGAGGTCGCGATCCGGCGCCTGCGCGCGAAGATCGACGACGCGTTTCCCGTCAAGCTGATCCATACCGTGCGCG
GCGTCGGCTACGTGCTCGAACCGAAGGACGACGCATGA

Protein sequence :
MRILIVEDEPKTGAYLKKGLEESGFSVDLAKDGGEGLTLAQEERYDVIVLDVMLPVLDGWAVLKRLRDTHTTPVLFLTAR
DDVQDRVHGLELGADDYLVKPFAFVELLARIRTLARRGPPRETEHLAVGDLEIDVVRRRVKRGATRIDLTPREFSLLQLL
ARRQGEVLSRTQIASYVWDMNFDSDTNVVEVAIRRLRAKIDDAFPVKLIHTVRGVGYVLEPKDDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-57 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator BAC0125 Protein 2e-73 69
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator BAC0197 Protein 1e-70 66
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator BAC0083 Protein 6e-70 63
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator BAC0638 Protein 1e-60 62
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator BAC0111 Protein 6e-64 59
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator BAC0308 Protein 8e-66 59
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator BAC0347 Protein 9e-59 56
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_002952.2859905.p0 Protein 2e-34 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 7e-39 44
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_007622.3794472.p0 Protein 1e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_002758.1121668.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_009641.5332272.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_013450.8614421.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_007793.3914279.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_002745.1124361.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_009782.5559369.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_002951.3237708.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_003923.1003749.p0 Protein 2e-34 43
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator AE015929.1.gene1106. Protein 1e-32 42
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 7e-31 42
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator HE999704.1.gene2815. Protein 7e-33 42
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator AE000516.2.gene3505. Protein 2e-30 42
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator NC_012469.1.7685629. Protein 1e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-58 56
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator VFG1389 Protein 1e-40 50
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator VFG1390 Protein 7e-43 49
Bcen2424_6324 YP_839949.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-38 44