Gene Information

Name : Bcen2424_0762 (Bcen2424_0762)
Accession : YP_834408.1
Strain :
Genome accession: NC_008542
Putative virulence/resistance : Resistance
Product : major facilitator transporter
Function : -
COG functional category : G : Carbohydrate transport and metabolism
COG ID : COG2814
EC number : -
Position : 853454 - 854653 bp
Length : 1200 bp
Strand : -
Note : PFAM: major facilitator superfamily MFS_1; KEGG: bcn:Bcen_0278 major facilitator superfamily MFS_1

DNA sequence :
ATGCTCTTGAACCCGTCCCTGATTGCCATCCTGGCCACGGTCCTGCTCGACGCGATCGGCGTCGGGATCGTGATGCCGAT
CCTGCCCGGGCTGCTGCGCTCGCTCGCCGCCGCGGGCAGCACCGACACCCACTACGGCATCCTGCTCGCGCTGTACGCGT
TCGCGCAGTTCCTGTGTGCGCCGCTGCTCGGCGCGCTGAGCGACCGTTTCGGTCGCCGCCCGGTGCTGCTCGCGTCGCTG
GCCGGCGCCGCGCTCGACTATCTGCTGATGGCGCTCGCGCCGACGCTCGCGTGGCTTTACGTCGGCCGGCTGATCGCGGG
CATCACCGGCGCGAACGCCGCGGTCGCGACCGCGTACGTGACCGACGTGACGGCCGAGCCCGACCGTGCACGGCGCTTCG
GCCAGCTCGGCGCGATGATGGGCATCGGCTTCATCGCCGGCCCGTTGATCGGCGGGCTGCTCGGCGTGCTGCATCTGCGT
GCGCCGTTCGTCGCGGCCGCGTTGCTCAACGCGCTGAATCTCCTGCTCGTATGGCGCGTGCTGCCGGAATCGCGGCCGCG
TTCTGCCCGCGAAGGCCAGGCGGTCGGCGCGCTCAACCCGTTCGCGAGCCTGCGCCGGCTGAGCGGCGCGCCCGCGCTCG
CGCCGCTGGTCGGCATCTACGTGATCGTGGCGCTCGTGTCGCAGGCGCCCGCGACGCTGTGGATTCTCTACGGCCAGGAA
CATTTCGGCTGGTCGACACCGGTCGCGGGGTTGTCGCTCGCCGGTTACGGCGCATGCCACGCGCTCGCGCAGGCGTTCGC
GATCGGGCCGCTGATCGCGCGGCTCGGCGAGCGGCGCGCGCTCGCGCTGGGCCTCGCGGGCGATGCGCTCGGGCTGGCGA
TCATCGCGTTCGCGACCGCCGCATGGGTGCCGTTCGCGCTGCTGCCGCTGTTCGCGGCTGGCGGCATGACGCTGCCGGCA
TTGCAGGCGATGCTCGCACGGCAGGTCGACGATGCACGCCAGGGAGAACTGCAAGGCACGCTGGCGAGCGTGGCGAGCCT
GATCGGCGTCGCGGGGCCGCTGGTCGTCACCGCGACCTACGCGGCGACGCGTACGACATGGCCAGGGCTCGTGTGGGCGG
CGGCCGCCCTGCTGTACCTGCTCGTGCCGCCGTTGCTGGCTGGCGCGCGCCCGGCGAACGCGCCGCGAGCGTCCGGATAA

Protein sequence :
MLLNPSLIAILATVLLDAIGVGIVMPILPGLLRSLAAAGSTDTHYGILLALYAFAQFLCAPLLGALSDRFGRRPVLLASL
AGAALDYLLMALAPTLAWLYVGRLIAGITGANAAVATAYVTDVTAEPDRARRFGQLGAMMGIGFIAGPLIGGLLGVLHLR
APFVAAALLNALNLLLVWRVLPESRPRSAREGQAVGALNPFASLRRLSGAPALAPLVGIYVIVALVSQAPATLWILYGQE
HFGWSTPVAGLSLAGYGACHALAQAFAIGPLIARLGERRALALGLAGDALGLAIIAFATAAWVPFALLPLFAAGGMTLPA
LQAMLARQVDDARQGELQGTLASVASLIGVAGPLVVTATYAATRTTWPGLVWAAAALLYLLVPPLLAGARPANAPRASG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetA YP_006098396.1 tetracycline resistance protein Not tested Tn2411 Protein 7e-62 55
tetA(A) ACK44537.1 TetA(A) Not tested SGI1 Protein 6e-62 55
tetA(A) AGK07027.1 TetA(A) Not tested SGI1 Protein 6e-62 55
tetA(A) AGK07085.1 TetA(A) Not tested SGI1 Protein 6e-62 55
tetA(A) ACN81011.1 TetA(A) Not tested AbaR5 Protein 4e-62 55
tetA CAJ77066.1 Tetracycline resistance protein Not tested AbaR1 Protein 3e-62 55
tetA CAJ77034.1 Tetracycline resistance protein Not tested AbaR1 Protein 4e-57 52
tetA(G) ABZ01843.1 TetA(G) Not tested SGI2 Protein 2e-55 52
tetA(G) AGK06974.1 TetA(G) Not tested SGI1 Protein 2e-55 52
tetA(G) AGK07104.1 TetA(G) Not tested SGI1 Protein 2e-55 52
tet(G) AAK02051.1 tetracycline resistance protein Not tested SGI1 Protein 2e-55 52
tetA(B) AEZ06045.1 tetracycline efflux protein Not tested Tn6167 Protein 9e-49 44
tetA(B) AAL08445.1 tetracycline resistance protein TetA(B) Not tested SRL Protein 7e-49 44
tetB AEA34667.1 tetracycline resistance determinant Not tested Not named Protein 6e-49 44
tet(H) YP_005176248.1 tetracycline efflux protein, class H Not tested ICEPmu1 Protein 7e-42 44
tetA(B) AEQ20905.1 tetracycline resistance protein Not tested Tn6166 Protein 1e-48 44
BJAB07104_00277 YP_008207742.1 Permeases of the major facilitator superfamily Not tested AbaR25 Protein 1e-48 44
BJAB0868_00281 YP_008211607.1 Permeases of the major facilitator superfamily Not tested AbaR26 Protein 1e-48 44
tetA YP_005797160.1 tetracycline resistance protein, class G (TETA(G)) Not tested AbaR4e Protein 3e-48 44
ABZJ_00260 YP_005524216.1 Tetracycline resistance protein, class B (TETA(B) ) (Metal-tetracycline/H(+) antiporter) Not tested AbaR22 Protein 1e-48 44
tetA(B) AFH57202.1 tetracycline resistance protein Not tested AbaR4a Protein 9e-49 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_0762 YP_834408.1 major facilitator transporter AY264780.2.gene3.p01 Protein 2e-87 70
Bcen2424_0762 YP_834408.1 major facilitator transporter AY743590.gene.p01 Protein 5e-74 58
Bcen2424_0762 YP_834408.1 major facilitator transporter Y19114.gene.p01 Protein 3e-69 55
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_011586.7045189.p0 Protein 2e-56 55
Bcen2424_0762 YP_834408.1 major facilitator transporter X75761.gene.p01 Protein 5e-62 55
Bcen2424_0762 YP_834408.1 major facilitator transporter CP001485.1.gene2821. Protein 2e-62 55
Bcen2424_0762 YP_834408.1 major facilitator transporter AF534183.gene.p01 Protein 1e-62 55
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_010410.6002597.p0 Protein 2e-62 55
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_010410.6002612.p0 Protein 3e-57 52
Bcen2424_0762 YP_834408.1 major facilitator transporter AF133140.gene.p01 Protein 3e-57 52
Bcen2424_0762 YP_834408.1 major facilitator transporter AF133139.gene.p01 Protein 6e-58 52
Bcen2424_0762 YP_834408.1 major facilitator transporter AF090987.gene.p01 Protein 1e-54 51
Bcen2424_0762 YP_834408.1 major facilitator transporter Y19116.gene.p01 Protein 6e-45 47
Bcen2424_0762 YP_834408.1 major facilitator transporter AF070999.gene.p01 Protein 3e-50 46
Bcen2424_0762 YP_834408.1 major facilitator transporter L06798.gene.p01 Protein 2e-44 46
Bcen2424_0762 YP_834408.1 major facilitator transporter L06940.gene.p01 Protein 5e-46 46
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_011595.7059241.p0 Protein 1e-43 44
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_011586.7043399.p0 Protein 1e-43 44
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_009085.4918440.p0 Protein 5e-41 44
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_010410.6003291.p0 Protein 8e-44 44
Bcen2424_0762 YP_834408.1 major facilitator transporter AF121000.gene.p01 Protein 1e-44 44
Bcen2424_0762 YP_834408.1 major facilitator transporter CP004022.1.gene2534. Protein 2e-43 44
Bcen2424_0762 YP_834408.1 major facilitator transporter AF038993.gene.p01 Protein 1e-43 44
Bcen2424_0762 YP_834408.1 major facilitator transporter V00611.gene.p01 Protein 5e-49 44
Bcen2424_0762 YP_834408.1 major facilitator transporter AB084246.gene.p01 Protein 7e-49 44
Bcen2424_0762 YP_834408.1 major facilitator transporter NC_010558.1.6275971. Protein 4e-49 44
Bcen2424_0762 YP_834408.1 major facilitator transporter Y15510.gene.p01 Protein 9e-43 44
Bcen2424_0762 YP_834408.1 major facilitator transporter AJ420072.gene.p01 Protein 2e-41 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_0762 YP_834408.1 major facilitator transporter VFG1036 Protein 4e-49 44