Gene Information

Name : Bcen2424_2618 (Bcen2424_2618)
Accession : YP_836261.1
Strain :
Genome accession: NC_008542
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2900243 - 2900905 bp
Length : 663 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bur:Bcep18194_A5949 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCGGATTCTGCTTGTCGAAGATGATCGAATGATTGCCGAGGGCGTGCGCAAGGCGCTGCGCTCGGACGGCTTTGCGGT
CGACTGGGTGCAGGACGGCGACGCCGCGCTCACCGCGCTCGGCGGCGAGACGTACGATCTGCTGCTGCTCGATCTCGGCC
TGCCGAAGCGCGACGGCATCGACGTGCTGCGCACGCTGCGCGGGCGCGGGCTCGCGCTGCCGGTGCTGATCGTCACCGCG
CGCGATGCCGTCGCCGATCGCGTGAAGGGGCTCGACGCGGGCGCCGACGACTACCTCGTCAAGCCGTTCGATCTCGACGA
GCTGGGCGCGCGGATGCGCGCGCTGATCCGCCGCCAGGCCGGGCGCAGCGAGTCGCTGATCCGCCACGGCGCGCTGACGC
TCGATCCCGCGTCGCACCAGGTGACGCTCGACGGTGCGCCCGTCGCGCTGTCCGCACGCGAGTTCGCGCTGCTCGAGGCG
CTGCTCGCGCGGCCGGGCGCGGTGCTGTCGAAGAGCCAGCTCGAGGAAAAGATGTACGGCTGGGGCGAGGAGATCGGCAG
CAACACGGTCGAGGTCTACATCCACGCGCTGCGCAAGAAGCTCGGCTCGGACCTGATCCGCAACGTGCGCGGGCTCGGCT
ACATGGTCGTCAAGGAAAGCTGA

Protein sequence :
MRILLVEDDRMIAEGVRKALRSDGFAVDWVQDGDAALTALGGETYDLLLLDLGLPKRDGIDVLRTLRGRGLALPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQAGRSESLIRHGALTLDPASHQVTLDGAPVALSAREFALLEA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGSDLIRNVRGLGYMVVKES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 3e-32 50
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-20 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-20 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_2618 YP_836261.1 two component transcriptional regulator BAC0487 Protein 1e-28 48
Bcen2424_2618 YP_836261.1 two component transcriptional regulator BAC0197 Protein 9e-25 45
Bcen2424_2618 YP_836261.1 two component transcriptional regulator BAC0083 Protein 5e-22 44
Bcen2424_2618 YP_836261.1 two component transcriptional regulator NC_002516.2.879194.p Protein 3e-22 43
Bcen2424_2618 YP_836261.1 two component transcriptional regulator BAC0638 Protein 4e-21 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_2618 YP_836261.1 two component transcriptional regulator VFG0473 Protein 1e-30 48
Bcen2424_2618 YP_836261.1 two component transcriptional regulator VFG1390 Protein 7e-30 47
Bcen2424_2618 YP_836261.1 two component transcriptional regulator VFG0596 Protein 7e-21 42
Bcen2424_2618 YP_836261.1 two component transcriptional regulator VFG1389 Protein 6e-21 41