Gene Information

Name : Bcen2424_1305 (Bcen2424_1305)
Accession : YP_834950.1
Strain :
Genome accession: NC_008542
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1435931 - 1436632 bp
Length : 702 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bcn:Bcen_0824 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCCCAGCAACATTCTCGTCGTTGAAGATGAGCCCGCGATTTCCGAACTGATCTCGGTGAATCTCCAGCACGCCGGTCA
CTGCCCGATCCGCGCTTACAACGCCGAACAGGCGCAGAACCTGATCAGCGACGTGCTGCCCGATCTCGTGCTGCTCGACT
GGATGCTGCCGGGCAAGTCCGGCATCGCGTTCGCGCGCGACCTGCGCAACAACGAACGGACCAAGCACATCCCGATCATC
ATGCTCACCGCCCGCGGCGACGAGCAGGACAAGGTGCTCGGCCTCGAAATCGGCGCGGACGACTACGTGACGAAGCCGTT
CTCGCCGAAGGAGCTGATGGCGCGCATCAAGGCCGTGCTGCGCCGCCGCGCGCCGCAGCTGACCGAGGACGTCGTGTCGA
TCAACGGGCTGCGCCTCGACCCGGCCACGCATCGCGTCGCCGCGCACGGCGACGGCAGCGAGATCAAGCTCGATCTCGGC
CCGACCGAGTTCCGCCTGCTGCATTTCTTCATGACGCATCCGGAGCGCGTGCACAGCCGCACGCAGCTGCTCGACCAGGT
GTGGGGCGACCACGTGTTCGTCGAGGAGCGTACCGTCGACGTGCACATCAAACGATTGCGCGCGGCCTTGAAACCGGCCG
GCTGCGATGCGATGATCGAAACCGTGCGCGGCAGCGGCTACCGCCTCGCCAAGCACGCGTAA

Protein sequence :
MPSNILVVEDEPAISELISVNLQHAGHCPIRAYNAEQAQNLISDVLPDLVLLDWMLPGKSGIAFARDLRNNERTKHIPII
MLTARGDEQDKVLGLEIGADDYVTKPFSPKELMARIKAVLRRRAPQLTEDVVSINGLRLDPATHRVAAHGDGSEIKLDLG
PTEFRLLHFFMTHPERVHSRTQLLDQVWGDHVFVEERTVDVHIKRLRAALKPAGCDAMIETVRGSGYRLAKHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-27 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-27 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-27 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_1305 YP_834950.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-37 43
Bcen2424_1305 YP_834950.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-31 42
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-39 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator CP004022.1.gene1676. Protein 9e-33 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-34 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator BAC0596 Protein 2e-34 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator BAC0039 Protein 1e-34 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator CP000034.1.gene2186. Protein 1e-34 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_002695.1.916589.p Protein 8e-35 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-34 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_010410.6002907.p0 Protein 6e-32 41
Bcen2424_1305 YP_834950.1 two component transcriptional regulator NC_011586.7046392.p0 Protein 6e-32 41