Gene Information

Name : Bcen2424_0123 (Bcen2424_0123)
Accession : YP_833770.1
Strain :
Genome accession: NC_008542
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 132287 - 132718 bp
Length : 432 bp
Strand : -
Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: regulatory protein, MerR; KEGG: bcn:Bcen_2932 transcriptional regulator, MerR family

DNA sequence :
ATGAAGATTGGCGAACTGGCCAAAGCGGCCCGCTGCACGCCCGAGACGATCCGTTTCTACGAGAAAGAGGGCCTAATGCC
GGATGCGGAGCGCACCGATTCGAACTACCGCAACTACACCGACGTGCACGTCGAGCGGCTGCGCTTCATCCGCAACTGCC
GCGCGCTCGACATGGCGCACGACGAAATCCGCGCGCTGCTGCAGCTCACCGACACGCCGGCGGACCGCTGCGATTCGATC
AATTCGCTGCTCGACGATCACATCGGACACGTCGACGCGCGCCTCGCGGAACTCACGCATCTGCGCGACCAGCTCACCGA
ATTGCGCCGCCAGTGCGTCGGCGAGCATTCGGTCGAGGATTGCGGCATCGTGCATGGCCTTGCGACGATGGAAACCGTCG
CGCCGGCCGCGAAGCGCTCGCACCTCGGCTGA

Protein sequence :
MKIGELAKAARCTPETIRFYEKEGLMPDAERTDSNYRNYTDVHVERLRFIRNCRALDMAHDEIRALLQLTDTPADRCDSI
NSLLDDHIGHVDARLAELTHLRDQLTELRRQCVGEHSVEDCGIVHGLATMETVAPAAKRSHLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ORF C98 AAN62191.1 putative transcriptional regulator Not tested PAGI-2(C) Protein 2e-31 49
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 1e-29 46
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 1e-29 46
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 9e-30 46
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 9e-30 46
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 3e-29 45
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 4e-29 45
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 2e-29 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcen2424_0123 YP_833770.1 MerR family transcriptional regulator BAC0058 Protein 6e-39 55
Bcen2424_0123 YP_833770.1 MerR family transcriptional regulator BAC0301 Protein 4e-31 53