Gene Information

Name : Arth_1441 (Arth_1441)
Accession : YP_830935.1
Strain : Arthrobacter sp. FB24
Genome accession: NC_008541
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1601364 - 1602107 bp
Length : 744 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sma:SAV4416 putative two-component system response regulator

DNA sequence :
GTGAACAAGTCCCAGCCGGCGCCGGTCCAGGCCGCAGTCGGAAACCGGCGGATACTCCTCGTCGAAGACGAACAGACCAT
CGCCGGAGTGGTCCGTGACTACCTTGTGCAGGCGGGCTTCCAGGTGGACCTCGCTGCGGACGGGTTCACGGCCCTGCGCC
TCGCGGCGGAGCGGCACCCGGACCTCGTCCTGCTGGACCGCATGCTGCCCGGCCTGGACGGCGTGGAAGTGTGCCGCAGG
CTCCGCCAGACGATGAGCGTCCCCGTCATTATGCTGACGGCCCTGGGGACGGAGGATGACAGGATCCTTGGACTGGAGGT
CGGTGCGGACGATTACATCACCAAGCCTTTCTCGCCCCGGGAACTGGTGCTCAGGGTGCGCTCTGTTTTGCGGCGCAGCG
TTCAGGAGTTCAGCCCCGAACCGGCGGTGCAAGTTGCCGGGTTCGAGCTCAACCCGGCAGCCCGGACCGTGACGCACCAC
GGATCTCCGCTCGCGCTGACCATCCGGGAGTTCGACCTTCTGGCCTTTTTCCTGCGCCGCCCCAACCAGGTGTTCAGCCG
CGAGGAGCTGATCAGGGCCGTGTGGGGCTGGGACTTCGGGGACCTCTCCACGGTCACCGTCCACGTCCGGCGGCTGCGCG
AAAAGATCGAGGCTGATCCCACCCGGCCGGCCCTCCTGAAGACGGTGTGGGGCGTGGGCTACCGGCTGGACACCCCGGAC
GGGGCTGACGGTGCAAACAGCTGA

Protein sequence :
MNKSQPAPVQAAVGNRRILLVEDEQTIAGVVRDYLVQAGFQVDLAADGFTALRLAAERHPDLVLLDRMLPGLDGVEVCRR
LRQTMSVPVIMLTALGTEDDRILGLEVGADDYITKPFSPRELVLRVRSVLRRSVQEFSPEPAVQVAGFELNPAARTVTHH
GSPLALTIREFDLLAFFLRRPNQVFSREELIRAVWGWDFGDLSTVTVHVRRLREKIEADPTRPALLKTVWGVGYRLDTPD
GADGANS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-32 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-31 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arth_1441 YP_830935.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-41 48
Arth_1441 YP_830935.1 two component transcriptional regulator BAC0111 Protein 9e-35 44
Arth_1441 YP_830935.1 two component transcriptional regulator NC_012469.1.7685629. Protein 7e-38 44
Arth_1441 YP_830935.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-40 43
Arth_1441 YP_830935.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-40 42
Arth_1441 YP_830935.1 two component transcriptional regulator BAC0347 Protein 4e-31 41
Arth_1441 YP_830935.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 9e-33 41
Arth_1441 YP_830935.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 9e-33 41
Arth_1441 YP_830935.1 two component transcriptional regulator BAC0638 Protein 4e-21 41
Arth_1441 YP_830935.1 two component transcriptional regulator BAC0083 Protein 4e-27 41
Arth_1441 YP_830935.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-36 41
Arth_1441 YP_830935.1 two component transcriptional regulator HE999704.1.gene2815. Protein 4e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arth_1441 YP_830935.1 two component transcriptional regulator VFG1389 Protein 2e-24 45
Arth_1441 YP_830935.1 two component transcriptional regulator VFG0596 Protein 1e-32 43
Arth_1441 YP_830935.1 two component transcriptional regulator VFG1390 Protein 1e-29 42
Arth_1441 YP_830935.1 two component transcriptional regulator VFG1563 Protein 4e-34 41
Arth_1441 YP_830935.1 two component transcriptional regulator VFG1702 Protein 2e-33 41